| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a024280m |
| Family | AA2 |
| Protein Properties | Length: 167 Molecular Weight: 18023.5 Isoelectric Point: 7.6908 |
| Chromosome | Chromosome/Scaffold: 139 Start: 61567 End: 63077 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA2 | 35 | 118 | 3.1e-24 |
| ITQELRIGASILRLFFHDCFVNGCDGSLLLDDTATFTGEKNAFPNRNSVRGYELIDTIKTRVEAACSATVSCADIVALAARDGV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 167 Download |
| SLLFSCSNAQ LSPNFYASTC PNLQLIVRNA MREAITQELR IGASILRLFF HDCFVNGCDG 60 SLLLDDTATF TGEKNAFPNR NSVRGYELID TIKTRVEAAC SATVSCADIV ALAARDGVGL 120 DSLVRFYSSN LNAFRADFAA AMVRMGNISP LTGANGEIRR NCRLVN* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03030 | PLN03030 | 0.0001 | 134 | 166 | 33 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 1.0e-17 | 123 | 165 | 43 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| PLN03030 | PLN03030 | 4.0e-31 | 15 | 122 | 108 | + cationic peroxidase; Provisional | ||
| pfam00141 | peroxidase | 4.0e-38 | 27 | 120 | 94 | + Peroxidase. | ||
| cd00693 | secretory_peroxidase | 1.0e-62 | 10 | 120 | 111 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD43561.1 | 0 | 2 | 120 | 13 | 133 | AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum] |
| GenBank | AAD43561.1 | 0.00000000000003 | 116 | 166 | 266 | 316 | AF155124_1 bacterial-induced peroxidase precursor [Gossypium hirsutum] |
| EMBL | CAN81400.1 | 0 | 3 | 118 | 16 | 132 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002281731.1 | 0 | 3 | 118 | 16 | 132 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002281731.1 | 0.00000000005 | 116 | 166 | 267 | 317 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1sch_B | 9.94922e-44 | 10 | 118 | 1 | 109 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_B | 0.00000000002 | 116 | 166 | 244 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 9.94922e-44 | 10 | 118 | 1 | 109 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 0.00000000002 | 116 | 166 | 244 | 294 | A Chain A, Peanut Peroxidase |
| PDB | 1qo4_A | 2e-38 | 10 | 120 | 2 | 112 | A Chain A, Peanut Peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BQ630076 | 120 | 1 | 120 | 0 |
| BE607598 | 120 | 1 | 120 | 0 |
| BM892672 | 120 | 1 | 120 | 0 |
| BW666335 | 120 | 1 | 120 | 0 |
| BE474984 | 120 | 1 | 120 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |