| Basic Information | |
|---|---|
| Species | Mimulus guttatus |
| Cazyme ID | mgv1a026072m |
| Family | CBM43 |
| Protein Properties | Length: 97 Molecular Weight: 10609.9 Isoelectric Point: 5.66 |
| Chromosome | Chromosome/Scaffold: 208 Start: 361460 End: 361807 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| CBM43 | 4 | 65 | 7.5e-21 |
| WCVADTNGPPAPSDAQFQGFIDYACGIVDCSPIQPGGSCYNPNYLVRHADYALNLYYKSRGV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 97 Download |
| KRPWCVADTN GPPAPSDAQF QGFIDYACGI VDCSPIQPGG SCYNPNYLVR HADYALNLYY 60 KSRGVCNTEI GTITSFDPCK FSLSLYNIAY TGCYYP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 8.0e-11 | 4 | 64 | 67 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-18 | 4 | 81 | 88 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK95331.1 | 0.00000000000005 | 1 | 96 | 365 | 452 | unknown [Populus trichocarpa] |
| EMBL | CAN61862.1 | 0.00000000000007 | 4 | 96 | 393 | 477 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_192648.2 | 0.00000000000003 | 3 | 64 | 30 | 88 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | XP_002509479.1 | 0.000000000000007 | 4 | 96 | 372 | 456 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| RefSeq | XP_002510373.1 | 0.00000000000006 | 1 | 96 | 370 | 457 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.0000000000006 | 4 | 78 | 13 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| GR181552 | 94 | 4 | 97 | 8e-20 |
| GO245609 | 96 | 2 | 97 | 4e-17 |
| EX670056 | 99 | 4 | 96 | 5e-16 |
| HS557505 | 101 | 1 | 96 | 8e-16 |
| HS557504 | 101 | 1 | 96 | 8e-16 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |