Basic Information | |
---|---|
Species | Mimulus guttatus |
Cazyme ID | mgv1a026756m |
Family | CBM43 |
Protein Properties | Length: 115 Molecular Weight: 12236.7 Isoelectric Point: 4.7337 |
Chromosome | Chromosome/Scaffold: 83 Start: 595918 End: 596339 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 76 | 8.8e-30 |
QTGFQIALDWACGLGKSDCGPIQPGGACFQPNTLLSHASYAFNSYYQENGNNDVACNFGGAAVLTPNNPTYAKC |
Full Sequence |
---|
Protein Sequence Length: 115 Download |
SSQTGFQIAL DWACGLGKSD CGPIQPGGAC FQPNTLLSHA SYAFNSYYQE NGNNDVACNF 60 GGAAVLTPNN PTYAKCLFPT SESLSSSSSK YYMETSVLWK INVILLFLVT FING* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-17 | 9 | 65 | 62 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-31 | 7 | 78 | 72 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ85566.1 | 9e-32 | 2 | 107 | 65 | 173 | unknown [Medicago truncatula] |
GenBank | ACU17215.1 | 7e-34 | 2 | 88 | 62 | 148 | unknown [Glycine max] |
EMBL | CBI30973.1 | 8e-37 | 2 | 104 | 610 | 714 | unnamed protein product [Vitis vinifera] |
GenBank | EAZ02781.1 | 2e-32 | 2 | 111 | 64 | 173 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
RefSeq | NP_001058896.1 | 5e-33 | 2 | 111 | 17 | 126 | Os07g0149900 [Oryza sativa (japonica cultivar-group)] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-19 | 10 | 80 | 29 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DW518050 | 109 | 2 | 108 | 1e-35 |
JK984738 | 78 | 3 | 80 | 2e-33 |
DT019806 | 79 | 2 | 80 | 4e-33 |
DT039619 | 79 | 2 | 80 | 7e-33 |
DT019261 | 79 | 2 | 80 | 1e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|