y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g006338m
FamilyGH100
Protein PropertiesLength: 651 Molecular Weight: 73153.8 Isoelectric Point: 6.3304
ChromosomeChromosome/Scaffold: 00323 Start: 49184 End: 54941
Descriptionalkaline/neutral invertase
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1001646210
  LEDEAWNLLRDSMVYYCGSPIGTIAANDPTSSNVLNYDQVFIRDFIPSGIAFLLKGEYDIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKVRTVPLD
  GDDSATEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLLVQERIDVQTGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQAL
  FYSALLCAREMLAPEDGSADLIRALNNRLVALSFHIREYYWIDLRKLNEIYRYKTEEYSYDAVNKFNIYPDQIPPWLVEWMPNKGGYLIGNLQPAHMDFR
  FFSLGNIWSIVNGLATRDQSHAILDLMEAKWADLVADMPLKICYPALEGQEWQIITGSDPKNTPWSYHNAGSWPTLLWQFTVACIKMNRPEIAARAVQVA
  EKRLSRDKWPEYYDTKRARFIGKQAQLFQTWSIAGYLVSKILLADPSAAKILTTEEDS
Full Sequence
Protein Sequence     Length: 651     Download
MGTSEAVLQV LSGANPLLFN SAKCSGNLDA TFPSRFLYKY TKKRVSRYKR LFNCSSTLQS    60
DLGLNWLKGL GYGLSGCREV NRLQLLSCKC QQAESVSGLT AEDGNGTWFV DSAKKLNLKS    120
VANTPNILEF QDVQQFEQEK KSFTSNGAAG TTIDSVSKAT VDCLEDEAWN LLRDSMVYYC    180
GSPIGTIAAN DPTSSNVLNY DQVFIRDFIP SGIAFLLKGE YDIVRNFILH TLQLQSWEKT    240
MDCHSPGQGL MPASFKVRTV PLDGDDSATE EVLDPDFGEA AIGRVAPVDS GLWWIILLRA    300
YGKCSGDLLV QERIDVQTGI KMILKLCLAD GFDMFPTLLV TDGSCMIDRR MGIHGHPLEI    360
QALFYSALLC AREMLAPEDG SADLIRALNN RLVALSFHIR EYYWIDLRKL NEIYRYKTEE    420
YSYDAVNKFN IYPDQIPPWL VEWMPNKGGY LIGNLQPAHM DFRFFSLGNI WSIVNGLATR    480
DQSHAILDLM EAKWADLVAD MPLKICYPAL EGQEWQIITG SDPKNTPWSY HNAGSWPTLL    540
WQFTVACIKM NRPEIAARAV QVAEKRLSRD KWPEYYDTKR ARFIGKQAQL FQTWSIAGYL    600
VSKILLADPS AAKILTTEED SELVNAFSCM ISANPRRKRG RKNLNQTYII *             660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.00752160487+
PLN02703PLN0270301650658+
pfam12899Glyco_hydro_1000167609443+
PLN03005PLN030050167623457+
PLN02973PLN029730167629469+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17063.1014165029541unnamed protein product [Vitis vinifera]
RefSeqXP_002264960.106765051635PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270071.1076650360923PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311958.101656501486predicted protein [Populus trichocarpa]
RefSeqXP_002532011.1016501663beta-fructofuranosidase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8112174891646510
HO7799054092436510
GO8726293421584990
HO8269711914626510
HO8269711392163540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00008.3Aquca_073_00008.2Aquca_073_00008.1Aquca_086_00036.1Aquca_004_00040.2
Aquca_004_00040.1Aquca_003_00442.1Aquca_073_00027.1
Arabidopsis lyrata489803491170472504891210316170
489110474815896781896678920675
332600
Arabidopsis thalianaAT4G34860.2AT4G34860.1AT4G09510.1AT1G22650.1AT1G72000.1
AT1G35580.2AT1G35580.1AT4G09510.2AT1G35580.3AT5G22510.1
AT1G56560.1AT3G06500.1AT3G05820.1
Brachypodium distachyonBradi3g45530.1Bradi5g10357.1Bradi4g24470.1Bradi3g02560.1Bradi4g24470.2
Bradi2g12427.1Bradi5g09200.1Bradi3g44770.1Bradi1g64150.1
Brassica rapaBra011567Bra034661Bra034659Bra024527Bra000681
Bra016091Bra034413Bra036761Bra002417Bra038926
Bra029583Bra040252
Carica papayaevm.model.supercontig_37.198evm.model.supercontig_66.27evm.model.supercontig_48.185evm.model.supercontig_19.1
Capsella rubellaCarubv10004468mCarubv10000493mCarubv10021707mCarubv10012014mCarubv10009286m
Carubv10000472mCarubv10020003mCarubv10013138mCarubv10015452mCarubv10000738m
Citrus clementinaCiclev10030393mCiclev10023282mCiclev10028002mCiclev10030926mCiclev10030925m
Ciclev10004474mCiclev10000500mCiclev10003220m
Citrus sinensisorange1.1g035779morange1.1g048475morange1.1g006332morange1.1g006329morange1.1g006328m
orange1.1g006324morange1.1g006488morange1.1g005783morange1.1g006131morange1.1g015270m
orange1.1g045990morange1.1g008699morange1.1g013067morange1.1g007986morange1.1g008801m
orange1.1g010424morange1.1g016169morange1.1g035960m
Cucumis sativusCucsa.381840.1Cucsa.079400.1Cucsa.309020.1Cucsa.252410.1Cucsa.090510.1
Cucsa.252410.2
Eucalyptus grandisEucgr.G01751.1Eucgr.F02588.1Eucgr.F01661.1Eucgr.D02386.1Eucgr.G02704.2
Eucgr.G02704.1Eucgr.J00457.3Eucgr.J00457.2Eucgr.J00457.1Eucgr.B03984.1
Eucgr.H03308.1Eucgr.H03308.2Eucgr.G02704.3
Fragaria vescamrna07792.1-v1.0-hybridmrna08524.1-v1.0-hybridmrna07379.1-v1.0-hybridmrna18695.1-v1.0-hybridmrna05019.1-v1.0-hybrid
mrna00239.1-v1.0-hybridmrna22002.1-v1.0-hybrid.383.643mrna22002.1-v1.0-hybrid.383.643mrna22002.1-v1.0-hybrid.156.364mrna22002.1-v1.0-hybrid.156.364
mrna26695.1-v1.0-hybrid
Glycine maxGlyma10g35890.4Glyma10g35890.3Glyma20g31730.2Glyma20g31730.1Glyma12g02690.2
Glyma04g00750.5Glyma04g00750.4Glyma04g00750.3Glyma04g00750.2Glyma06g00770.3
Glyma06g00770.2Glyma05g31920.2Glyma05g31920.1Glyma08g15220.1Glyma20g22780.1
Glyma10g28640.1Glyma17g04160.1Glyma07g36440.1Glyma03g38970.2Glyma19g41500.2
Glyma17g04160.2Glyma11g10400.2.237.371Glyma11g10400.2.237.371
Gossypium raimondiiGorai.005G252100.2Gorai.005G252100.1Gorai.013G139600.2Gorai.013G139600.1Gorai.006G130500.3
Gorai.006G130500.2Gorai.006G130500.1Gorai.009G289200.1Gorai.002G123500.1Gorai.004G151200.1
Gorai.007G110200.1Gorai.006G130500.4Gorai.009G289200.2Gorai.006G110700.1Gorai.011G203600.1
Gorai.002G145500.6Gorai.002G145500.5Gorai.002G145500.4Gorai.002G145500.3Gorai.002G145500.2
Gorai.002G145500.1Gorai.013G208200.2Gorai.013G208200.1Gorai.012G023500.1Gorai.004G235500.1
Gorai.007G308100.1Gorai.013G130600.1Gorai.006G110700.2Gorai.011G203600.2Gorai.006G110700.3
Gorai.002G145500.7Gorai.004G235500.2Gorai.004G235500.4Gorai.004G235500.3
Linum usitatissimumLus10042390Lus10033144Lus10026284Lus10034525Lus10014824
Lus10016938Lus10006078Lus10019532Lus10043375Lus10037817
Lus10017095Lus10010900Lus10031431Lus10009441.256.528Lus10009441.256.528
Lus10009441.88.195Lus10009441.88.195
Malus domesticaMDP0000163452MDP0000319075MDP0000186866MDP0000849174MDP0000531557
MDP0000146680MDP0000297851MDP0000652278MDP0000133399MDP0000095481
MDP0000315220MDP0000275203MDP0000261740MDP0000798088MDP0000133829
MDP0000291284
Manihot esculentacassava4.1_005201mcassava4.1_004783mcassava4.1_004474mcassava4.1_004633mcassava4.1_022884m
cassava4.1_003659mcassava4.1_003155mcassava4.1_002913mcassava4.1_021277mcassava4.1_002971m
cassava4.1_025660m
Medicago truncatulaMedtr1g096140.1Medtr1g095970.1Medtr3g117710.1Medtr8g092170.1Medtr1g084610.1
Medtr3g015100.1
Mimulus guttatusmgv1a005865mmgv1a003765mmgv1a023298mmgv1a002815mmgv1a005735m
mgv1a002478mmgv1a002839mmgv1a002360mmgv1a006717m
Oryza sativaLOC_Os02g34560.1LOC_Os04g35280.1LOC_Os11g07440.3LOC_Os11g07440.1LOC_Os02g03320.1
LOC_Os02g34560.2LOC_Os11g07440.4LOC_Os11g07440.2LOC_Os02g32730.1LOC_Os01g22900.1
LOC_Os03g20020.1LOC_Os04g33490.1LOC_Os01g22900.3LOC_Os01g22900.2
Panicum virgatumPavirv00040169mPavirv00015193mPavirv00065954mPavirv00063699mPavirv00064389m
Pavirv00045650mPavirv00000123mPavirv00050023mPavirv00060635mPavirv00019972m
Pavirv00039825mPavirv00059532mPavirv00039824mPavirv00017654mPavirv00063916m
Pavirv00053033m.234.378Pavirv00053033m.234.378
Physcomitrella patensPp1s227_41V6.1Pp1s261_25V6.1Pp1s32_177V6.1Pp1s333_36V6.1Pp1s245_40V6.1
Pp1s15_44V6.1Pp1s279_35V6.1Pp1s313_22V6.1
Phaseolus vulgarisPhvul.007G091300.1Phvul.009G000400.1Phvul.002G266600.1Phvul.007G203100.1Phvul.001G224200.1
Phvul.003G118400.1
Picea abiesMA_7394g0010MA_10436888g0010MA_116385g0010MA_89855g0010MA_10427675g0010
MA_10427685g0010MA_10429278g0010.102.302MA_10429278g0010.102.302MA_458344g0010MA_10425903g0010
MA_3665942g0010MA_6692890g0010MA_10309672g0010MA_182953g0010MA_10429278g0010.338.431
MA_10429278g0010.338.431
Populus trichocarpaPotri.004G167500.1Potri.013G110800.1Potri.019G082000.3Potri.019G082000.2Potri.019G082000.1
Potri.009G129000.1Potri.005G239400.1Potri.002G173600.1Potri.004G186500.1Potri.010G236100.1
Potri.008G024100.2Potri.008G024100.1Potri.008G101500.3Potri.008G101500.2Potri.008G101500.1
Potri.013G006600.1Potri.005G010800.2Potri.005G010800.1Potri.004G186500.2Potri.013G006600.2
Potri.010G236100.2
Prunus persicappa004112mppa003483mppa003670mppa025225mppa002149m
ppa002625mppa002614mppa002847mppa002385mppa019684m
ppa014917mppa018196mppb023165m
Ricinus communis29728.m00079929836.m00058329791.m00054629766.m00011629889.m003349
30128.m00893529711.m000330.251.52129711.m000330.251.52130170.m014184.294.48030170.m014184.294.480
30170.m014184.135.29330170.m014184.135.29356962.m00005529711.m000330.112.22929711.m000330.112.229
56962.m000054
Setaria italicaSi016798mSi009717mSi026182mSi016786mSi016890m
Si016691mSi000681mSi034714mSi009683m
Selaginella moellendorffii11139389558151264267827443960
Sorghum bicolorSb04g022350.1Sb04g029440.1Sb05g004770.1Sb04g002180.1Sb03g013420.1
Sb04g021550.1Sb01g037120.1Sb02g032885.1
Thellungiella halophilaThhalv10024783mThhalv10028553mThhalv10007305mThhalv10001814mThhalv10019647m
Thhalv10012973mThhalv10020219mThhalv10023341mThhalv10020291mThhalv10017815m
Vitis viniferaGSVIVT01009904001GSVIVT01034488001GSVIVT01027176001GSVIVT01024105001GSVIVT01037430001
GSVIVT01031374001GSVIVT01034944001GSVIVT01031267001GSVIVT01037429001GSVIVT01034754001
GSVIVT01034753001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)