y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g006506m
FamilyGT8
Protein PropertiesLength: 644 Molecular Weight: 72142.7 Isoelectric Point: 8.3608
ChromosomeChromosome/Scaffold: 00036 Start: 463922 End: 470460
Descriptiongalacturonosyltransferase 7
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT83156150
  CLSMRLTVEYFKSPSVVMELSQADRFSDPSLHHYVIFSTNVLASSVVINSTVLCARESKNQVFHVLTDGQNYFAMKLWFFRNTFKEATVQVLNIEQLNLE
  SHDKAILIHMFLPVEYRVSLLSVDGPSIHSKMQYISVFSHLHYLLPEIFQSLTKVVVLDDDVVVQKDLSALWDINMGGKVNGAVQSCSVSLGQLKSYLGE
  NSYDKNSCAWMSGLNIVDLARWRELDLTKTYQRLVREVSMGEESKEAVALRGSLLTFQDLVYALDGVWALSGLGHDYGLNIEAIKKAAVLHYNGNMKPWL
  E
Full Sequence
Protein Sequence     Length: 644     Download
MKGGGGGGGG GAVLVTTGKR RWRSLVIGVL FLVILSMLVP LAFLLGLHNG FHSPNPNPNG    60
YVPVHKTSIV SDLKIYDKYE NSETFNHAEN YRSTRINDLV KKLAPNISKD VRSNFPDGAK    120
TETSDMSATD TSHHSKVTPV SPPAVPQSLP NTSNSKIAGT VADSGRGGVD ENENCELKFG    180
SYCLWRREHR EEMKDTMVKK LKDQLFVARA YYPSIAKLPS QDKLTRALRQ NIQEVERVLS    240
ESATDVDLPP GIEKKIQRME AAITKAKSVP VDCSNVDKKF RQILDMTNDE ANFHMKQSAF    300
LYQLAVQTMP KSLHCLSMRL TVEYFKSPSV VMELSQADRF SDPSLHHYVI FSTNVLASSV    360
VINSTVLCAR ESKNQVFHVL TDGQNYFAMK LWFFRNTFKE ATVQVLNIEQ LNLESHDKAI    420
LIHMFLPVEY RVSLLSVDGP SIHSKMQYIS VFSHLHYLLP EIFQSLTKVV VLDDDVVVQK    480
DLSALWDINM GGKVNGAVQS CSVSLGQLKS YLGENSYDKN SCAWMSGLNI VDLARWRELD    540
LTKTYQRLVR EVSMGEESKE AVALRGSLLT FQDLVYALDG VWALSGLGHD YGLNIEAIKK    600
AAVLHYNGNM KPWLELGIPR YKKFWKKFLN QEDQLLSECN VHP*                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02742PLN027422.0e-83191642470+
PLN02910PLN029101.0e-102180641479+
PLN02718PLN027181.0e-10220642636+
PLN02829PLN028293.0e-11019643660+
PLN02769PLN02769018642631+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAQ58617.1016964359541transferase, transferring glycosyl groups / unknown protein [Vitis vinifera]
RefSeqXP_002264525.104964348613PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002323701.10152643128620glycosyltransferase, CAZy family GT8 [Populus trichocarpa]
RefSeqXP_002326255.1015464398590glycosyltransferase [Populus trichocarpa]
RefSeqXP_002519984.1016564296575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.0000244661376252A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1g9r_A0.0000244661376252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.000744661376252A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
Transmembrane Domains
StartEnd
2547
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY28024334313400
DY28771030513020
DY28691626512650
DY286916292652930.000000000002
DY287710852513280.001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)