y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g007886m
FamilyGH77
Protein PropertiesLength: 587 Molecular Weight: 65343.8 Isoelectric Point: 6.2557
ChromosomeChromosome/Scaffold: 00063 Start: 245707 End: 251976
Descriptiondisproportionating enzyme
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH77945780
  LHPTSFRGPYGIGDFGAEAFRFIDWLHQAGCSVWQVLPLVPPGRKANEEGSPYSGQDANCGNTLLISLEELVKDGLLAKAELPQPIDAERVNFAAVADLK
  DPLIAKAAERLIQSDGELKSQLENFHKDPSISSWLEDAAYFAAIDDSLNTFSWYLWPESLKNRHLAALEEIYQSKKDFIDLFIAQQFLFQRQWQKVRNYA
  QMKGISIMGDMPIYVGYHSADVWANKKHFLLNRRGFPLEVSGVPPDAFSETGQLWGSPLYDWKAMEKDGFSWWIHRIRRARDLYDEFRIDHFRGFAGFWA
  VPSEAKVAMDGRWKVGPGKSLFDAIFRSVGNINIIAEDLGVITEDVVQLRKSIGAPGMAVLQFGFGSDSKNPHLPHNHERNQVVYTGTHDNDTIRSWWDT
  SKNEEKSNVMKYLSISEEDDISWKLIQAALSSVAQTAVIPLQDILRLGVSARMNIPATQFGNWSWRIPSSTSFDRLETEATKLRD
Full Sequence
Protein Sequence     Length: 587     Download
MAALGSLSFS SLASSSSSSP KPSSFLATAT LRPRFFLCTP FAAKTSAASA SCSSVSGNAA    60
ASAVASVGQD LPDDYEEWTP KPDPRDRRRA GVLLHPTSFR GPYGIGDFGA EAFRFIDWLH    120
QAGCSVWQVL PLVPPGRKAN EEGSPYSGQD ANCGNTLLIS LEELVKDGLL AKAELPQPID    180
AERVNFAAVA DLKDPLIAKA AERLIQSDGE LKSQLENFHK DPSISSWLED AAYFAAIDDS    240
LNTFSWYLWP ESLKNRHLAA LEEIYQSKKD FIDLFIAQQF LFQRQWQKVR NYAQMKGISI    300
MGDMPIYVGY HSADVWANKK HFLLNRRGFP LEVSGVPPDA FSETGQLWGS PLYDWKAMEK    360
DGFSWWIHRI RRARDLYDEF RIDHFRGFAG FWAVPSEAKV AMDGRWKVGP GKSLFDAIFR    420
SVGNINIIAE DLGVITEDVV QLRKSIGAPG MAVLQFGFGS DSKNPHLPHN HERNQVVYTG    480
THDNDTIRSW WDTSKNEEKS NVMKYLSISE EDDISWKLIQ AALSSVAQTA VIPLQDILRL    540
GVSARMNIPA TQFGNWSWRI PSSTSFDRLE TEATKLRDLL STYGRL*                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00217malQ2.0e-11486585510+
COG1640MalQ3.0e-13781585521+
PLN02635PLN02635068586519+
PRK14508PRK14508087586503+
pfam02446Glyco_hydro_77094583506+
Gene Ontology
GO TermDescription
GO:00041344-alpha-glucanotransferase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1X1N0635861524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
EMBLCBI21503.105558654585unnamed protein product [Vitis vinifera]
Swiss-ProtQ068010115868576DPEP_SOLTU RecName: Full=4-alpha-glucanotransferase, chloroplastic/amyloplastic; AltName: Full=Amylomaltase; AltName: Full=Disproportionating enzyme; Short=D-enzyme; Flags: Precursor
RefSeqXP_002276109.105558652583PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310024.1015861574predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1x1n_A0635861524A Chain A, Structure Determination And Refinement At 1.8 A Resolution Of Disproportionating Enzyme From Potato
PDB1tz7_B08858522503A Chain A, Aquifex Aeolicus Amylomaltase
PDB1tz7_A08858522503A Chain A, Aquifex Aeolicus Amylomaltase
PDB2x1i_A0915868500A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
PDB1fp9_A0885605477A Chain A, Glycoside Hydrolase Family 77 4-Alpha-Glucanotransferase From Thermus Brockianus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO4350354791085850
DY280898333283600
DY278054314283380
DY289721309283350
ES8050872992845820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00493.1Aquca_014_00493.2Aquca_009_00054.2Aquca_009_00054.1Aquca_009_00054.3.267.859
Arabidopsis lyrata496706483146
Arabidopsis thalianaAT5G64860.1AT2G40840.1
Brachypodium distachyonBradi1g20790.1Bradi1g18650.1.259.907
Brassica rapaBra037799Bra004590
Carica papayaevm.model.supercontig_196.11evm.model.supercontig_92.60
Capsella rubellaCarubv10026154mCarubv10022587m
Chlamydomonas reinhardtiiCre03.g181500.t1.2g1899.t1
Citrus clementinaCiclev10025236mCiclev10025748mCiclev10025303m.221.544Ciclev10025303m.221.544Ciclev10025303m.94.221
Ciclev10025303m.94.221Ciclev10010989m.279.926
Citrus sinensisorange1.1g009906morange1.1g002052m.279.926orange1.1g002050m.279.926orange1.1g002027m.279.929
Cucumis sativusCucsa.250500.2Cucsa.250500.1Cucsa.250500.10
Eucalyptus grandisEucgr.I00325.1Eucgr.K01679.1.272.918
Fragaria vescamrna31442.1-v1.0-hybridmrna31443.1-v1.0-hybridmrna00258.1-v1.0-hybrid.543.676mrna00258.1-v1.0-hybrid.543.676
Glycine maxGlyma04g39730.1Glyma06g15140.1Glyma03g27600.1.272.920Glyma19g30580.1.272.920
Gossypium raimondiiGorai.003G047100.1Gorai.003G047100.2Gorai.003G047100.3Gorai.003G047100.4Gorai.010G128900.7.272.586
Gorai.010G128900.6.272.586Gorai.010G128900.3Gorai.010G128900.5Gorai.010G128900.4Gorai.010G128900.2
Gorai.010G128900.1
Linum usitatissimumLus10035845Lus10036626Lus10035408.186.791Lus10031010.709.828Lus10031010.709.828
Lus10031010.709.828Lus10031010.348.710Lus10031010.348.710Lus10031010.348.710Lus10031010.186.329
Lus10031010.186.329Lus10031010.186.329
Malus domesticaMDP0000243418.304.467MDP0000243418.304.467MDP0000243418.154.302MDP0000243418.154.302MDP0000149290.248.921
Manihot esculentacassava4.1_008552mcassava4.1_001086m.256.903
Medicago truncatulaMedtr3g094840.1Medtr7g088740.3Medtr7g088740.1.278.801Medtr7g088740.1.278.801Medtr7g088740.2.57.569
Medtr7g088740.2.57.569Medtr7g088740.2.581.734Medtr7g088740.2.581.734Medtr7g088740.1.813.966Medtr7g088740.1.813.966
Mimulus guttatusmgv1a004209m.70.300mgv1a004209m.70.300mgv1a004209m.302.523mgv1a004209m.302.523mgv1a000923m.250.897
Oryza sativaLOC_Os07g43390.1LOC_Os07g46790.1.269.917
Panicum virgatumPavirv00011352mPavirv00008161mPavirv00039603mPavirv00069371m.297.611Pavirv00070133m
Pavirv00069370m.297.826Pavirv00069369m.272.920
Physcomitrella patensPp1s44_268V6.1Pp1s117_77V6.1Pp1s8_30V6.1Pp1s253_27V6.1
Phaseolus vulgarisPhvul.009G139500.1Phvul.001G117700.1
Picea abiesMA_10429341g0010MA_225933g0010MA_1108864g0010MA_10433631g0010MA_10432229g0010
Populus trichocarpaPotri.007G081400.1Potri.006G031700.4Potri.016G028900.3Potri.016G028900.2Potri.016G028900.1
Potri.006G031700.3Potri.006G031700.2Potri.006G031700.1
Prunus persicappa003327mppa011408mppa000782m.305.951
Ricinus communis29719.m00033330045.m000475.200.845
Setaria italicaSi029329mSi034110m.272.920Si028900m.276.863Si028839m.276.923
Selaginella moellendorffii109836444105427302268243
Sorghum bicolorSb02g040000.1Sb02g042100.1.268.916
Thellungiella halophilaThhalv10003902mThhalv10016195m
Vitis viniferaGSVIVT01022223001GSVIVT01025810001.273.921
Volvox carteriVocar20008073mVocar20014639m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)