y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g011979m
FamilyGT33
Protein PropertiesLength: 474 Molecular Weight: 53297.9 Isoelectric Point: 6.7818
ChromosomeChromosome/Scaffold: 00144 Start: 150082 End: 154253
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3364620
  RACVVVLGDLGRSPRMQYQALSLARQMSLEVDVVAYGGSKPHAAILEHPSIHIHTMTQWPTIPRGLPKVLKPVLLLLKPLIQFFMLLWFLCVKIASPDVF
  LVQNPPSVPTLVAVKWASSLRRSAFIVDWHNFGYTLLSLSLGRRSHFVSIYRWIEKYYGKMANGCLCVTQAMQHELAQNWGIKATVLYDQPPEFFHPTSL
  EEKHELFCRLNKILHQPLGVQDCVSNGMEGQKADETIFTSLAGIDVFLKPNRPALVVSSTSWTPDEDFGILLEAALMYDRRVAAILNEDDSTNEEVFLKE
  ISDGKQYLYPRLLFIITGKGPDKESYEEKIRRLRLKRVAFRTMWLSAEDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCGLPVCAVSYSCIEELVKV
  DKNGLLFSSSSELADQLLMLFKGFPDDSDVLKKLRNGTLEMGLSARWATEWEEHAKP
Full Sequence
Protein Sequence     Length: 474     Download
MGRRGRACVV VLGDLGRSPR MQYQALSLAR QMSLEVDVVA YGGSKPHAAI LEHPSIHIHT    60
MTQWPTIPRG LPKVLKPVLL LLKPLIQFFM LLWFLCVKIA SPDVFLVQNP PSVPTLVAVK    120
WASSLRRSAF IVDWHNFGYT LLSLSLGRRS HFVSIYRWIE KYYGKMANGC LCVTQAMQHE    180
LAQNWGIKAT VLYDQPPEFF HPTSLEEKHE LFCRLNKILH QPLGVQDCVS NGMEGQKADE    240
TIFTSLAGID VFLKPNRPAL VVSSTSWTPD EDFGILLEAA LMYDRRVAAI LNEDDSTNEE    300
VFLKEISDGK QYLYPRLLFI ITGKGPDKES YEEKIRRLRL KRVAFRTMWL SAEDYPLLLG    360
SADLGVCLHT SSSGLDLPMK VVDMFGCGLP VCAVSYSCIE ELVKVDKNGL LFSSSSELAD    420
QLLMLFKGFP DDSDVLKKLR NGTLEMGLSA RWATEWEEHA KPLITEVISQ FDD*          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG3.0e-10312454145+
COG0438RfaG2.0e-1088461383+
cd03794GT1_wbuB_like2.0e-1289442364+
PLN02275PLN0227501426426+
cd03816GT1_ALG1_like04464463+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.1014709481unnamed protein product [Vitis vinifera]
RefSeqNP_173105.1014731464glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002283369.101469124595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.1014671468predicted protein [Populus trichocarpa]
RefSeqXP_002532170.1044708473beta1,4 mannosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY29267027312730
DY27887133213290
DY30295525812580
DY30078633213280
DY278871852513310.0001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2Glyma08g18130.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)