y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g016742m
FamilyPL1
Protein PropertiesLength: 384 Molecular Weight: 42989.3 Isoelectric Point: 7.6702
ChromosomeChromosome/Scaffold: 00227 Start: 97830 End: 103247
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11122910
  IVFEVSGTIHLRSHLSVSSYKTIDGRGQRVKLTGKGLRLKECEHVIICNLEFEGGKGPDVDAIQIKPKSKHIWIDRCSLRDYDDGLIDITRESTDITVSR
  CHFSSHDKTMLIGADPSHVADRCIRVTIHHCFFDGTRQRHPRVRYAKVHLYNNYTRNWGIYAVCASVDSQIYSQCNIYEA
Full Sequence
Protein Sequence     Length: 384     Download
MGNSHGHHHH HRNEANSYFP HQTPTPTPPP FKFGPSDHHQ HQPAAQFQNN STMSLPYAHV    60
DCSLRALAGQ AEGFGRLAIG GLHGPLYHVT TLADDGPGSL REGCRMKEPL WIVFEVSGTI    120
HLRSHLSVSS YKTIDGRGQR VKLTGKGLRL KECEHVIICN LEFEGGKGPD VDAIQIKPKS    180
KHIWIDRCSL RDYDDGLIDI TRESTDITVS RCHFSSHDKT MLIGADPSHV ADRCIRVTIH    240
HCFFDGTRQR HPRVRYAKVH LYNNYTRNWG IYAVCASVDS QIYSQCNIYE AGQKKMAFKY    300
LTEKASDKEE ARSGCIRSEG DLFITGTQAG LMTEAGEHSM FHPSEYYPTW TVAAPTDNLK    360
QVLQHCTGWQ DIQRPADQPV AAQ*                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C4.0e-38107287201+
COG3866PelB1.0e-4480357297+
smart00656Amb_all8.0e-68126292179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93648.1013831386unknown [Populus trichocarpa]
GenBankABK96132.1013831389unknown [Populus trichocarpa]
RefSeqXP_002277576.1013821373PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309435.10543834333predicted protein [Populus trichocarpa]
RefSeqXP_002323433.10543834333predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B1e-396734721327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A1e-396734721327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A3e-26123289125330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A1e-257929722254A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB3vmw_A3e-2213329082247A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY28969035833570
DY271752307163220
FC888541294163090
DY28396430813080
DY271752293223500.000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048morange1.1g020121m
orange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)