y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g021456m
FamilyGT57
Protein PropertiesLength: 313 Molecular Weight: 35651.4 Isoelectric Point: 8.2084
ChromosomeChromosome/Scaffold: 00071 Start: 386034 End: 389271
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57463100
  LLVRVAVSLHPYSGAGSPPKFGDYEAQRHWMEITLNLPVLEWYRNSTSNDLSYWGLDYPPLTAYQSYFHGLFLRFFDPDSVSLFTSRGYETYVGKLLMRW
  TVLSSDTLIFFPAIFYFAFVYHSSCHSSRKNDCAWHIAMLLLNPCLILIDHGHFQYNCISLGLTVAAIAAILSQRELLASCLFTLALSHKQMSVYYAPAF
  FSHLLGKCLRRKNPIHGVAKLGLTVLGTFTVVWWPYLHSTDALLGVLSRLAPFERGIYEDYVANF
Full Sequence
Protein Sequence     Length: 313     Download
MGKKKEKKKI NEKVDVEAVE IEDDTWWWLT HKGIGATFLC ISVFALLVRV AVSLHPYSGA    60
GSPPKFGDYE AQRHWMEITL NLPVLEWYRN STSNDLSYWG LDYPPLTAYQ SYFHGLFLRF    120
FDPDSVSLFT SRGYETYVGK LLMRWTVLSS DTLIFFPAIF YFAFVYHSSC HSSRKNDCAW    180
HIAMLLLNPC LILIDHGHFQ YNCISLGLTV AAIAAILSQR ELLASCLFTL ALSHKQMSVY    240
YAPAFFSHLL GKCLRRKNPI HGVAKLGLTV LGTFTVVWWP YLHSTDALLG VLSRLAPFER    300
GIYEDYVANF CK*                                                       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg81.0e-8545310270+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.1013101309hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.1013101314ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.1043103303PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.104931015277predicted protein [Populus trichocarpa]
RefSeqXP_002329281.104931011273predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
3352
143165
260282
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT559534273222930
EB680102238222590
FS330727239222600
CV719616186602450
CV719616321320.004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619mcassava4.1_005541m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny