y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g022635m
FamilyPL1
Protein PropertiesLength: 295 Molecular Weight: 33516.1 Isoelectric Point: 7.6688
ChromosomeChromosome/Scaffold: 00024 Start: 1066618 End: 1069273
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1242030
  IVFEVSGTIHLSSYLSVSSYKTIDGRGQRIKLTGKGLRLKECEHVIICNLEFEGGRGHDVDGIQIKPNSRHIWIDRCSLRDYDDGLIDITRQSTDITVSR
  CYFTQHDKTMLIGADPSHVGDRCIRVTIHHCLFDGTRQRHPRLRFGKVHLYNNYTRNWGIYAVCASVESQIYSQCNIYEA
Full Sequence
Protein Sequence     Length: 295     Download
MCLFIDDGPG SLREGCRRRE PLWIVFEVSG TIHLSSYLSV SSYKTIDGRG QRIKLTGKGL    60
RLKECEHVII CNLEFEGGRG HDVDGIQIKP NSRHIWIDRC SLRDYDDGLI DITRQSTDIT    120
VSRCYFTQHD KTMLIGADPS HVGDRCIRVT IHHCLFDGTR QRHPRLRFGK VHLYNNYTRN    180
WGIYAVCASV ESQIYSQCNI YEAGQKKRTF EYYTEKAADK LEAKSGLIRS EGDIFLKGAQ    240
AQLLTGVGEE CVFHPSEYYP TWTMEAPSDS LKQILQICTG WQSIPRPADV MIAN*         300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C5.0e-4025199195+
COG3866PelB5.0e-4721269269+
smart00656Amb_all3.0e-7038204179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK92527.10429026312unknown [Populus trichocarpa]
EMBLCAB75748.10428951336pectate lyase-like protein [Arabidopsis thaliana]
RefSeqNP_191074.20428941326pectate lyase family protein [Arabidopsis thaliana]
RefSeqNP_974439.10428917302pectate lyase family protein [Arabidopsis thaliana]
RefSeqXP_002311134.10429041327predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B2e-35525951327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A2e-35525951327A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A7e-272520149246A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A3e-2640201130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A9e-204520982257A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY27528229262950
CX54628625862630
CX546287253432950
CD574040252442950
FC88466027162760
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1Phvul.007G160100.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)