y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g023261m
FamilyGT8
Protein PropertiesLength: 286 Molecular Weight: 33017.7 Isoelectric Point: 8.2106
ChromosomeChromosome/Scaffold: 00028 Start: 666140 End: 667413
Descriptiongalacturonosyltransferase-like 10
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT822580
  TLDPEYLRGTIAAVHSVLKHTSCPENVFFHFIAAESSPANTNDLAQTVRSAFPYLSFQVYLFREKFVTGLISSSIRRALDSPLNYARIYLADILEPSIKR
  VIYLDSDVIVVDDIQKLWRIPLSGGRTIGAPEYCHANFTKYFSDEFWSDREFSRVFEGKRPCYFNTGVMVMDLVRWREGDYTRKIEKWMRIQKERRIYEL
  GSLPPFLLVFGGDVEAIDHRWNQHGLGGHNVENSCRNLHAGPVSLMHWSGKGKPWVR
Full Sequence
Protein Sequence     Length: 286     Download
MTLDPEYLRG TIAAVHSVLK HTSCPENVFF HFIAAESSPA NTNDLAQTVR SAFPYLSFQV    60
YLFREKFVTG LISSSIRRAL DSPLNYARIY LADILEPSIK RVIYLDSDVI VVDDIQKLWR    120
IPLSGGRTIG APEYCHANFT KYFSDEFWSD REFSRVFEGK RPCYFNTGVM VMDLVRWREG    180
DYTRKIEKWM RIQKERRIYE LGSLPPFLLV FGGDVEAIDH RWNQHGLGGH NVENSCRNLH    240
AGPVSLMHWS GKGKPWVRLD AKKPCPVDYL WAPYDLYNSH THSQY*                   300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02742PLN027424.0e-2382284204+
cd00505Glyco_transf_83.0e-274258260+
cd04194GT8_A4GalT_like2.0e-281256270+
cd06429GT8_like_15.0e-325259274+
pfam01501Glyco_transf_87.0e-671260260+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_189474.20128075352GATL10 (Galacturonosyltransferase-like 10); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqNP_564983.10127786362LGT8 (GLUCOSYL TRANSFERASE FAMILY 8); polygalacturonate 4-alpha-galacturonosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002271160.10128080359PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311853.10127781359glycosyltransferase, CAZy family GT8 [Populus trichocarpa]
RefSeqXP_002517421.10128571355transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.0000013025833254B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB1g9r_A0.0000013025833254A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.0000013025833254A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3tzt_B0.007117910171A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3tzt_A0.007117910171A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC922473267202860
DY305817267202860
CX070315233542860
DY29689622912290
DY296896372222580.0006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00358.1Aquca_017_00377.1Aquca_007_00136.1Aquca_002_01104.1Aquca_010_00404.1
Aquca_026_00195.1Aquca_003_00612.1Aquca_002_00392.1
Arabidopsis lyrata486764490360476133905093906411
472678470231477926472152471480
Arabidopsis thalianaAT3G62660.1AT4G02130.3AT4G02130.2AT4G02130.1AT3G50760.1
AT3G28340.1AT1G70090.2AT1G70090.1AT1G24170.1AT1G02720.2
AT1G02720.1AT3G06260.1AT1G19300.1AT1G13250.1
Brachypodium distachyonBradi1g64830.1Bradi1g61830.1Bradi5g16690.1Bradi1g12560.1Bradi3g59760.1
Bradi1g44470.1
Brassica rapaBra041026Bra003504Bra025325Bra030163Bra016237
Bra039058Bra012890Bra012417Bra024642Bra020762
Bra032589Bra001188Bra016512Bra025726Bra019820
Bra040231
Carica papayaevm.model.supercontig_37.85evm.model.supercontig_151.46evm.model.supercontig_16.63evm.model.supercontig_5.324evm.model.supercontig_14.73
evm.model.supercontig_1.221evm.model.supercontig_9.124
Capsella rubellaCarubv10017525mCarubv10017523mCarubv10020432mCarubv10018870mCarubv10018975m
Carubv10011392mCarubv10001309mCarubv10015151mCarubv10009529mCarubv10012618m
Carubv10010952m
Citrus clementinaCiclev10020715mCiclev10001658mCiclev10031574mCiclev10031831mCiclev10025952m
Ciclev10020857mCiclev10015791m
Citrus sinensisorange1.1g017643morange1.1g042515morange1.1g047424morange1.1g018567morange1.1g018535m
Cucumis sativusCucsa.205260.1Cucsa.096860.1Cucsa.342110.1Cucsa.101770.1Cucsa.232430.1
Cucsa.285670.1Cucsa.283880.1Cucsa.084880.1
Eucalyptus grandisEucgr.A00485.1Eucgr.B02574.1Eucgr.B03054.1Eucgr.K03408.1Eucgr.H01923.1
Eucgr.I01882.1Eucgr.H01534.1Eucgr.F01531.1
Fragaria vescamrna03873.1-v1.0-hybridmrna29514.1-v1.0-hybridmrna00730.1-v1.0-hybridmrna15079.1-v1.0-hybridmrna06069.1-v1.0-hybrid
mrna01325.1-v1.0-hybridmrna27629.1-v1.0-hybrid
Glycine maxGlyma10g01960.1Glyma02g01880.2Glyma02g01880.1Glyma17g36650.1Glyma06g03770.1
Glyma01g38520.1Glyma04g03690.1Glyma02g11100.1Glyma02g06640.1Glyma01g22480.1
Glyma14g08430.1Glyma07g38430.1Glyma17g02330.1Glyma02g03090.1Glyma19g01910.1
Glyma03g37560.1Glyma19g40180.1Glyma01g04460.1Glyma13g04780.1
Gossypium raimondiiGorai.001G142100.1Gorai.007G125600.5Gorai.007G125600.4Gorai.007G125600.3Gorai.007G125600.2
Gorai.007G125600.1Gorai.009G274300.1Gorai.008G142800.3Gorai.008G142800.2Gorai.008G142800.1
Gorai.009G094500.1Gorai.003G017900.1Gorai.009G205300.1Gorai.007G207000.2Gorai.007G207000.1
Gorai.005G187600.1Gorai.002G129800.1Gorai.009G345300.1Gorai.010G012700.1Gorai.009G094500.2
Gorai.007G133400.1Gorai.011G181200.1Gorai.008G070000.1Gorai.005G106100.2Gorai.005G106100.1
Gorai.012G058400.1
Linum usitatissimumLus10010727Lus10029215Lus10010025Lus10016301Lus10032728
Lus10018801Lus10002440Lus10030821Lus10013296Lus10012765
Lus10034012Lus10041489Lus10034274Lus10000262Lus10001461
Malus domesticaMDP0000794936MDP0000146240MDP0000856834MDP0000370712MDP0000401001
MDP0000185643MDP0000489408MDP0000678218MDP0000518347MDP0000124674
MDP0000467113MDP0000862557MDP0000534564MDP0000315192MDP0000120125
MDP0000190839MDP0000738777MDP0000282390MDP0000234929MDP0000261375
MDP0000745582
Manihot esculentacassava4.1_009251mcassava4.1_010284mcassava4.1_010677mcassava4.1_030032mcassava4.1_010644m
cassava4.1_010619mcassava4.1_030190mcassava4.1_010034mcassava4.1_032470mcassava4.1_027013m
cassava4.1_010840mcassava4.1_027039mcassava4.1_027652m
Medicago truncatulaMedtr6g008900.1Medtr4g071620.1Medtr8g078240.1Medtr7g109210.1Medtr3g092310.1
Medtr5g019220.1Medtr5g036580.1Medtr1g089820.1
Mimulus guttatusmgv1a027115mmgv1a019931mmgv1a006996mmgv1a025873mmgv1a009253m
mgv1a009521mmgv1a022129mmgv11b016267mmgv1a012428mmgv1a023917m
Oryza sativaLOC_Os03g18890.1LOC_Os04g44850.1LOC_Os02g50600.1LOC_Os06g13760.1LOC_Os03g47530.1
LOC_Os03g24510.1LOC_Os07g45260.1LOC_Os10g31650.1
Panicum virgatumPavirv00013322mPavirv00014799mPavirv00024693mPavirv00043544mPavirv00057337m
Pavirv00044356mPavirv00029444mPavirv00011574mPavirv00060955mPavirv00006973m
Pavirv00012530mPavirv00040941mPavirv00040847mPavirv00030626mPavirv00044928m
Physcomitrella patensPp1s4_405V6.1Pp1s129_133V6.1Pp1s229_15V6.2Pp1s229_15V6.1Pp1s281_1V6.1
Pp1s43_42V6.1Pp1s44_257V6.1Pp1s78_207V6.2Pp1s78_207V6.1Pp1s10_51V6.2
Pp1s10_51V6.1Pp1s29_210V6.1
Phaseolus vulgarisPhvul.007G217100.1Phvul.009G055600.1Phvul.003G097800.1Phvul.002G026000.1Phvul.003G251200.1
Phvul.001G016900.1Phvul.003G027400.1Phvul.007G168700.1Phvul.002G077400.1Phvul.001G211100.1
Phvul.004G022700.1
Picea abiesMA_10432403g0010MA_130934g0010MA_88535g0010MA_766299g0010MA_10429227g0010
Populus trichocarpaPotri.010G038300.1Potri.014G040300.1Potri.002G200200.1Potri.008G116900.1Potri.002G132900.1
Potri.014G125000.1Potri.007G031700.1Potri.010G129400.1Potri.005G128000.1Potri.008G018100.1
Potri.008G192600.1Potri.010G242300.1
Prunus persicappa007216mppa007794mppa007777mppa006911mppa007313m
ppa021809mppa007162mppa008099m
Ricinus communis29822.m00342329703.m00153930170.m01398729738.m00104829250.m000233
29736.m00210429726.m00393729986.m001675
Setaria italicaSi039250mSi012092mSi017541mSi006389mSi036413m
Si040204mSi030368m
Selaginella moellendorffii234804437525
Sorghum bicolorSb01g037870.1Sb06g023460.1Sb10g008830.1Sb04g028460.1Sb01g012060.1
Sb02g041310.1Sb01g034770.1
Thellungiella halophilaThhalv10006057mThhalv10006055mThhalv10028760mThhalv10028758mThhalv10004449m
Thhalv10018687mThhalv10008011mThhalv10007867mThhalv10021020mThhalv10010596m
Thhalv10008059mThhalv10007975m
Vitis viniferaGSVIVT01028072001GSVIVT01020141001GSVIVT01009639001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)