Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g025445m |
Family | GH31 |
Protein Properties | Length: 253 Molecular Weight: 28933 Isoelectric Point: 5.3146 |
Chromosome | Chromosome/Scaffold: 01866 Start: 7629 End: 10841 |
Description | heteroglycan glucosidase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH31 | 41 | 235 | 0 |
EVWPGPCVFPDYTQSKVRSWWGSLVKDFIYNGVDGIWNDMNEPAVFKSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMARSTYEGMKLADKDKRPF VLTRAGFIGSQRYAATWTGDNVSNWEHLHMSISMVLQLGLSGQPFSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDAIDHEPWSFGEEV |
Full Sequence |
---|
Protein Sequence Length: 253 Download |
MILIREFVRT FREKGIPCDV IWMDIDYMDG FRCFTFDKAW EVWPGPCVFP DYTQSKVRSW 60 WGSLVKDFIY NGVDGIWNDM NEPAVFKSVT KTMPESNIHR GDDEIGGCQN HSYYHNVYGM 120 LMARSTYEGM KLADKDKRPF VLTRAGFIGS QRYAATWTGD NVSNWEHLHM SISMVLQLGL 180 SGQPFSGPDI GGFDGNATPR LFGRWMGIGA MFPFCRGHTE SDAIDHEPWS FGEEVLFCSS 240 IVIIAFFWFK LE* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd06603 | GH31_GANC_GANAB_alpha | 1.0e-6 | 11 | 51 | 41 | + This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae. | ||
cd06603 | GH31_GANC_GANAB_alpha | 6.0e-77 | 43 | 236 | 198 | + This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae. | ||
pfam01055 | Glyco_hydro_31 | 6.0e-90 | 4 | 236 | 287 | + Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases. | ||
cd06604 | GH31_glucosidase_II_MalA | 2.0e-120 | 4 | 236 | 289 | + Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. | ||
PLN02763 | PLN02763 | 1.0e-151 | 4 | 235 | 287 | + hydrolase, hydrolyzing O-glycosyl compounds |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI37476.1 | 0 | 2 | 246 | 279 | 575 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_566736.1 | 0 | 4 | 234 | 215 | 500 | HGL1 (heteroglycan glucosidase 1); hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
RefSeq | XP_002263148.1 | 0 | 2 | 246 | 196 | 491 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002326592.1 | 0 | 4 | 246 | 225 | 516 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519886.1 | 0 | 4 | 246 | 215 | 509 | neutral alpha-glucosidase ab precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2g3n_F | 1e-37 | 41 | 228 | 282 | 490 | A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase |
PDB | 2g3n_E | 1e-37 | 41 | 228 | 282 | 490 | A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase |
PDB | 2g3n_D | 1e-37 | 41 | 228 | 282 | 490 | A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase |
PDB | 2g3n_C | 1e-37 | 41 | 228 | 282 | 490 | A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase |
PDB | 2g3n_B | 1e-37 | 41 | 228 | 282 | 490 | A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN187286 | 213 | 41 | 253 | 0 |
EY689465 | 210 | 41 | 250 | 0 |
GE582368 | 206 | 41 | 246 | 0 |
ES901722 | 206 | 41 | 246 | 0 |
ES911816 | 206 | 41 | 246 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|