y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g028660m
FamilyGH28
Protein PropertiesLength: 207 Molecular Weight: 21863.2 Isoelectric Point: 4.3966
ChromosomeChromosome/Scaffold: 00137 Start: 180048 End: 181232
Descriptionpolygalacturonase abscission zone A. thaliana
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2821940
  VTAPGDSPNTDGIHVTNTQNIRITSSTIGTGDDCISIVSGSQNVQAQDITCGPGHGISIGSLGKGNSNAYVSEVTVDGAKLSETANGVRIKTWQGGSGYA
  SNIIFQNIDMVNVKNPIIIDQNYCDQDDPCKEQSSAVHIKNVVFKNIRGTSASDEAVKLDCSKSYPCEAIVLENINLQSEEDEPKALCNNVDD
Full Sequence
Protein Sequence     Length: 207     Download
MVTAPGDSPN TDGIHVTNTQ NIRITSSTIG TGDDCISIVS GSQNVQAQDI TCGPGHGISI    60
GSLGKGNSNA YVSEVTVDGA KLSETANGVR IKTWQGGSGY ASNIIFQNID MVNVKNPIII    120
DQNYCDQDDP CKEQSSAVHI KNVVFKNIRG TSASDEAVKL DCSKSYPCEA IVLENINLQS    180
EEDEPKALCN NVDDLAQRGS VFPRCP*                                        240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03010PLN030101.0e-572193193+
PLN02188PLN021881.0e-622192195+
pfam00295Glyco_hydro_281.0e-751192192+
PLN02793PLN027932.0e-812180179+
PLN02218PLN022181.0e-922205204+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002274775.101205242448PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308956.102206239443predicted protein [Populus trichocarpa]
RefSeqXP_002313308.101205171375predicted protein [Populus trichocarpa]
RefSeqXP_002322711.102205249452predicted protein [Populus trichocarpa]
RefSeqXP_002529616.101206268474Polygalacturonase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bhe_A3e-182181192364A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB2iq7_G1e-164192144331A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_F1e-164192144331A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_E1e-164192144331A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_D1e-164192144331A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU88878020722070
DV15281220712060
DN49582420722070
EH76796120622060
EH75694120622060
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00125.1Aquca_037_00071.1Aquca_020_00147.1Aquca_061_00050.1Aquca_242_00002.1
Aquca_020_00129.3Aquca_020_00129.2Aquca_020_00129.1Aquca_020_00130.1Aquca_020_00129.4
Aquca_025_00355.1Aquca_002_00126.1Aquca_025_00355.2Aquca_029_00086.1Aquca_003_00408.1
Aquca_003_00411.1Aquca_005_00511.1Aquca_002_00126.2Aquca_002_00126.3Aquca_014_00768.1
Aquca_020_00127.1Aquca_003_00408.2
Arabidopsis lyrata877129486197477239474834483267
484425857359326950316947872183
488306326150893483471186891621
887386327610860213857358313215
479028912805917084884179857360
Arabidopsis thalianaAT1G23460.1AT1G70500.1AT1G80170.1AT2G41850.1AT3G57510.1
AT3G26610.1AT1G80140.1AT5G27530.1AT3G07970.1AT5G17200.1
AT1G60590.1AT1G10640.1AT5G14650.1AT1G56710.1AT1G48100.1
AT4G01890.1AT1G02460.1AT4G32380.1AT3G15720.1AT4G35670.1
AT5G44840.1AT5G44830.1AT4G32375.1AT3G15720.2AT4G32370.1
AT5G39910.1
Brachypodium distachyonBradi2g33080.1Bradi2g46400.1Bradi2g18060.1Bradi1g04630.1Bradi1g04610.1
Bradi2g18050.1Bradi1g69760.1Bradi2g18040.1Bradi2g44750.2Bradi2g44750.1
Bradi2g11380.1Bradi2g12400.1Bradi2g33437.1Bradi2g14880.1Bradi3g02850.1
Bradi1g51310.1Bradi2g18030.1Bradi5g18370.1Bradi2g04550.1Bradi2g04520.1
Brassica rapaBra016912Bra016911Bra024602Bra016213Bra004655
Bra012375Bra016345Bra003555Bra007332Bra003286
Bra025216Bra018707Bra008748Bra023600Bra018429
Bra031724Bra027148Bra019912Bra027926Bra032600
Bra000911Bra033328Bra008572Bra025631Bra027211
Bra027210Bra001605Bra029690Bra001279Bra025099
Bra025103Bra011341Bra008493
Carica papayaevm.model.supercontig_69.86evm.model.supercontig_92.36evm.model.supercontig_125.9evm.model.supercontig_69.85evm.model.supercontig_108.28
evm.model.supercontig_69.66evm.model.supercontig_69.65evm.model.supercontig_733.1evm.model.supercontig_146.54evm.model.supercontig_259.7
evm.model.supercontig_125.10evm.model.supercontig_37.67evm.model.supercontig_10.230evm.model.supercontig_10.242evm.model.supercontig_10.250
evm.model.supercontig_10.252
Capsella rubellaCarubv10011268mCarubv10025174mCarubv10017263mCarubv10020232mCarubv10019065m
Carubv10003877mCarubv10018919mCarubv10003570mCarubv10022105mCarubv10006248m
Carubv10015662mCarubv10003473mCarubv10008765mCarubv10020088mCarubv10022386m
Carubv10008991mCarubv10008847mCarubv10007643mCarubv10027840mCarubv10013685m
Carubv10006920mCarubv10028151mCarubv10007828mCarubv10006733m
Citrus clementinaCiclev10033386mCiclev10027523mCiclev10024556mCiclev10033716mCiclev10027366m
Ciclev10010440mCiclev10030577mCiclev10031220mCiclev10015111mCiclev10004899m
Ciclev10004898mCiclev10005317mCiclev10026919mCiclev10027074mCiclev10027137m
Citrus sinensisorange1.1g013309morange1.1g040748morange1.1g017991morange1.1g041470morange1.1g041224m
orange1.1g047738morange1.1g037736morange1.1g046362morange1.1g009748morange1.1g040454m
orange1.1g012057morange1.1g015319morange1.1g039868m.129.335orange1.1g039868m.129.335orange1.1g043061m
Cucumis sativusCucsa.286160.1Cucsa.249050.1Cucsa.127930.1Cucsa.105310.3Cucsa.105310.2
Cucsa.105310.1Cucsa.286260.1Cucsa.286160.2Cucsa.286260.2Cucsa.093830.1
Cucsa.286150.1Cucsa.394250.1Cucsa.339820.1Cucsa.135180.1Cucsa.192550.1
Cucsa.128570.1Cucsa.096470.1Cucsa.286160.3Cucsa.158450.1Cucsa.132050.1
Eucalyptus grandisEucgr.J01279.1Eucgr.J00557.1Eucgr.H02555.1Eucgr.G03373.1Eucgr.J03054.1
Eucgr.H02537.1Eucgr.A02373.1Eucgr.H04092.2Eucgr.B03312.1Eucgr.B03312.2
Eucgr.I01777.1Eucgr.B01667.1Eucgr.H04092.1Eucgr.C02788.1Eucgr.C02787.1
Eucgr.C02785.1Eucgr.C01750.1Eucgr.C01172.1Eucgr.B01677.1Eucgr.H01308.1
Eucgr.F02531.1Eucgr.I01918.1Eucgr.H00895.1
Fragaria vescamrna05877.1-v1.0-hybridmrna08295.1-v1.0-hybridmrna24528.1-v1.0-hybridmrna03600.1-v1.0-hybridmrna26823.1-v1.0-hybrid
mrna08290.1-v1.0-hybridmrna00293.1-v1.0-hybridmrna23005.1-v1.0-hybridmrna31029.1-v1.0-hybridmrna00430.1-v1.0-hybrid
mrna05284.1-v1.0-hybridmrna28438.1-v1.0-hybrid.113.298mrna28438.1-v1.0-hybrid.113.298mrna25737.1-v1.0-hybridmrna17262.1-v1.0-hybrid
mrna17261.1-v1.0-hybridmrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.225.503mrna11646.1-v1.0-hybrid.544.785
mrna11646.1-v1.0-hybrid.544.785mrna11646.1-v1.0-hybrid.544.785
Glycine maxGlyma02g31540.1Glyma10g17550.1Glyma18g19586.1Glyma08g39315.1Glyma15g01250.6
Glyma15g01250.5Glyma15g01250.4Glyma15g01250.2Glyma15g01250.1Glyma19g32241.2
Glyma19g32241.1Glyma03g29420.2Glyma15g43080.2Glyma10g11480.2Glyma09g35870.2
Glyma15g01250.15Glyma15g01250.14Glyma15g01250.13Glyma15g01250.12Glyma15g01250.10
Glyma15g01250.9Glyma15g01250.8Glyma15g01250.7Glyma15g01250.3Glyma15g01250.11
Glyma03g38140.1Glyma12g01480.1Glyma19g40740.1Glyma19g41430.2Glyma05g08730.1
Glyma01g03400.1Glyma02g04230.1Glyma13g44140.2Glyma15g01166.1Glyma15g43080.3
Glyma03g23680.2Glyma07g12321.1Glyma18g19670.1Glyma08g39340.1Glyma08g39340.2
Glyma19g00230.1Glyma02g01230.1Glyma10g01290.1Glyma08g09300.3Glyma08g09300.2
Glyma15g14540.1Glyma09g03620.2Glyma05g26390.2Glyma05g26390.1Glyma05g26390.3
Glyma11g16430.3Glyma14g04850.1Glyma12g00630.1Glyma11g16430.2Glyma11g16430.1
Glyma03g23881.1Glyma03g23701.1Glyma14g24151.1Glyma01g14500.2
Gossypium raimondiiGorai.002G185500.4Gorai.002G185500.3Gorai.002G185500.2Gorai.002G185500.1Gorai.004G066400.1
Gorai.005G181300.1Gorai.010G226900.1Gorai.007G360000.1Gorai.009G336100.1Gorai.002G185500.5
Gorai.006G024400.1Gorai.006G137600.2Gorai.006G137600.1Gorai.013G209100.1Gorai.005G131300.1
Gorai.006G137600.5Gorai.005G181400.1Gorai.012G172100.1Gorai.001G263400.1Gorai.005G181400.2
Gorai.007G120000.1Gorai.005G069900.2Gorai.005G069900.1Gorai.006G266100.1Gorai.008G136700.1
Gorai.012G172100.2Gorai.006G266100.2Gorai.004G037600.1Gorai.006G023900.1Gorai.006G024200.1
Gorai.010G230300.1Gorai.001G206100.1Gorai.006G137600.4Gorai.006G137600.3Gorai.011G082400.1
Gorai.011G082200.1Gorai.011G082200.2Gorai.008G136700.2
Linum usitatissimumLus10036084Lus10042371Lus10019711Lus10029511Lus10030602
Lus10026299Lus10029121Lus10040610Lus10013025Lus10030604
Lus10030886Lus10029140Lus10009994Lus10038059Lus10037834
Lus10017109Lus10018302Lus10040604Lus10002727Lus10014826
Lus10036205Lus10016940Lus10030888Lus10029139Lus10032875
Lus10026798Lus10036035
Malus domesticaMDP0000558179MDP0000175757MDP0000278254MDP0000448747MDP0000236404
MDP0000233407MDP0000152045MDP0000201484MDP0000209148MDP0000159240
MDP0000249386MDP0000911278MDP0000168416MDP0000147902MDP0000205197
MDP0000326734MDP0000209147MDP0000943790MDP0000247672MDP0000135108
MDP0000128761MDP0000201485MDP0000229391MDP0000296416MDP0000470297
MDP0000127265MDP0000240113MDP0000264703MDP0000161623MDP0000258005
MDP0000220329MDP0000902285MDP0000184620
Manihot esculentacassava4.1_031445mcassava4.1_006824mcassava4.1_026153mcassava4.1_007446mcassava4.1_031312m
cassava4.1_030998mcassava4.1_028947mcassava4.1_027248mcassava4.1_021446mcassava4.1_031845m
cassava4.1_030434mcassava4.1_030872mcassava4.1_028890mcassava4.1_031681mcassava4.1_005619m
cassava4.1_022910mcassava4.1_006790mcassava4.1_021247mcassava4.1_006566mcassava4.1_026469m
cassava4.1_031716mcassava4.1_030372mcassava4.1_032307m
Medicago truncatulaMedtr2g103410.1Medtr2g060350.1Medtr7g110050.1Medtr3g030540.1Medtr7g113910.1
Medtr5g033680.1Medtr3g084380.1Medtr2g103650.1Medtr5g034090.1Medtr6g005630.1
Medtr2g032710.1Medtr1g086390.1Medtr4g034020.1Medtr5g043350.1Medtr8g008700.1
Medtr8g077320.1Medtr4g084050.1Medtr3g084360.1Medtr1g012390.1Medtr1g013740.1
Medtr1g013730.1Medtr8g006500.1
Mimulus guttatusmgv1a006357mmgv1a007235mmgv1a022147mmgv1a007521mmgv1a022836m
mgv1a018728mmgv1a017703mmgv1a018832mmgv1a018762mmgv1a004469m
mgv1a005582mmgv1a021443mmgv1a025252mmgv1a021591mmgv1a019677m
mgv1a026845mmgv1a005106m.145.343mgv1a005106m.145.343mgv1a018285m
Oryza sativaLOC_Os05g46510.1LOC_Os07g10680.1LOC_Os07g10700.1LOC_Os07g10740.1LOC_Os03g59330.1
LOC_Os02g03750.1LOC_Os05g46520.1LOC_Os03g11760.1LOC_Os01g44970.1LOC_Os01g36830.1
LOC_Os01g45060.1LOC_Os06g28670.1LOC_Os05g50260.1LOC_Os01g19170.1LOC_Os05g20020.1
LOC_Os07g10730.1LOC_Os01g07790.1
Panicum virgatumPavirv00010581mPavirv00065133mPavirv00037995mPavirv00061958mPavirv00023691m
Pavirv00022563mPavirv00027329mPavirv00052008mPavirv00062373mPavirv00000296m
Pavirv00036539mPavirv00064503mPavirv00068511mPavirv00062256mPavirv00029885m
Pavirv00056401mPavirv00061957mPavirv00043148mPavirv00052352mPavirv00054995m
Pavirv00028598mPavirv00068858mPavirv00068857mPavirv00031268mPavirv00023724m
Pavirv00054407mPavirv00044311mPavirv00011290mPavirv00013243mPavirv00011100m
Pavirv00042645mPavirv00016919mPavirv00070806mPavirv00039836m
Physcomitrella patensPp1s104_31V6.1Pp1s16_66V6.1Pp1s17_289V6.1
Phaseolus vulgarisPhvul.003G061700.1Phvul.005G175800.1Phvul.001G135100.2Phvul.001G135100.1Phvul.001G215900.1
Phvul.007G211400.1Phvul.011G015100.1Phvul.002G063500.1Phvul.005G022500.1Phvul.005G177000.1
Phvul.010G037400.1Phvul.010G018000.1Phvul.010G037300.1Phvul.003G061600.1Phvul.004G011800.1
Phvul.002G189400.1Phvul.006G121300.2Phvul.006G121300.1Phvul.008G157500.1Phvul.010G037700.1
Phvul.010G037100.1Phvul.010G037900.1Phvul.010G037200.1Phvul.010G036600.1Phvul.001G266200.1
Phvul.010G038100.1Phvul.010G037800.1Phvul.010G038000.1
Picea abiesMA_133473g0010MA_127755g0010MA_925858g0010MA_17570g0010MA_21072g0010
MA_754919g0010MA_90135g0010MA_285723g0010MA_101764g0010MA_640601g0010
MA_10433901g0010MA_63122g0010
Populus trichocarpaPotri.008G211900.1Potri.009G060400.1Potri.001G463000.1Potri.011G159000.1Potri.016G054800.1
Potri.001G171900.5Potri.001G171900.1Potri.010G044000.1Potri.001G171900.3Potri.008G188300.1
Potri.006G252900.1Potri.008G189200.1Potri.010G042100.4Potri.010G042100.1Potri.001G346800.1
Potri.001G346800.2Potri.010G042100.5Potri.010G042100.6Potri.010G042100.2Potri.010G042100.3
Potri.005G005500.1Potri.002G190600.1Potri.013G005000.1Potri.014G115700.1Potri.010G152000.2
Potri.010G152000.1Potri.008G100500.1Potri.002G190600.2Potri.010G042100.7Potri.002G190600.3
Potri.012G119700.1Potri.018G028700.1Potri.006G052700.1Potri.001G171900.4Potri.001G171900.2
Potri.001G199300.1Potri.008G100500.3Potri.008G100500.2Potri.015G088600.1
Prunus persicappb008505mppa026655mppa014982mppa022427mppa024649m
ppa1027214mppa014719mppa018519mppa004002mppa018113m
ppa005391mppa021095mppa023489mppa019727mppa021427m
ppa015822mppa015678mppa021385m
Ricinus communis29761.m00041729864.m00150029631.m00101329841.m00282530128.m008960
27504.m00061329848.m00463929917.m00198329631.m00101429889.m003362
30076.m00459129841.m002840.35.35229841.m002840.35.35229617.m00013929841.m002840.467.705
29841.m002840.467.70529848.m004640
Setaria italicaSi032233mSi022189mSi016953mSi031920mSi038799m
Si039483mSi038685mSi003853mSi000958mSi021744m
Si003854mSi006382mSi001228mSi021901mSi035806m
Si004128mSi021758mSi032719mSi011984m
Selaginella moellendorffii11126654363859478908578038
3390912909405348
Sorghum bicolorSb09g027150.1Sb01g004220.1Sb04g002530.1Sb01g042735.1Sb06g025345.1
Sb09g029500.1Sb03g025260.1Sb01g004230.1Sb03g029030.1Sb03g012280.1
Sb01g004190.1Sb03g013310.1Sb09g027160.1Sb03g004360.1Sb03g013330.1.146.351
Sb03g013330.1.146.351
Thellungiella halophilaThhalv10018548mThhalv10006630mThhalv10019797mThhalv10016680mThhalv10005982m
Thhalv10023906mThhalv10004137mThhalv10013501mThhalv10013641mThhalv10023404m
Thhalv10007255mThhalv10011452mThhalv10007481mThhalv10023928mThhalv10023886m
Thhalv10027434mThhalv10020758mThhalv10020740mThhalv10019484mThhalv10001153m
Thhalv10027449mThhalv10027457mThhalv10021935mThhalv10001187mThhalv10029273m
Thhalv10028331m
Vitis viniferaGSVIVT01033364001GSVIVT01033362001GSVIVT01013772001GSVIVT01017279001GSVIVT01033360001
GSVIVT01033303001GSVIVT01031298001GSVIVT01032117001GSVIVT01008061001GSVIVT01013800001
GSVIVT01032447001GSVIVT01013771001GSVIVT01017644001GSVIVT01028189001GSVIVT01028132001
GSVIVT01017307001GSVIVT01033359001GSVIVT01032118001GSVIVT01017302001GSVIVT01017305001
GSVIVT01008062001GSVIVT01038447001GSVIVT01017304001GSVIVT01032114001
Zea maysAC210013.4_FGT017
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)