Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g030837m |
Family | AA2 |
Protein Properties | Length: 171 Molecular Weight: 18492.1 Isoelectric Point: 8.6771 |
Chromosome | Chromosome/Scaffold: 00014 Start: 1142611 End: 1145639 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 26 | 167 | 0 |
FIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVS |
Full Sequence |
---|
Protein Sequence Length: 171 Download |
MTKNYPTVSE DYKKAVEKCK RKLRGFIAEK NCAPLMLRIA WHSAGTYDVK TKTGGPFGTM 60 RLAAEQAHSA NNGLDIAVRL LEPFKEQFPT ISYADLYQLA GVVGVEVTGG PDIPFHPGRD 120 DKAEPPQEGR LPDAKQGNDH LRQVFGAQMG LSDKDIVALS GGHTLVSAKL * 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 4.0e-42 | 26 | 164 | 148 | + Peroxidase. | ||
PLN02608 | PLN02608 | 3.0e-86 | 6 | 165 | 160 | + L-ascorbate peroxidase | ||
PLN02879 | PLN02879 | 7.0e-89 | 1 | 165 | 165 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 3.0e-91 | 5 | 165 | 165 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02364 | PLN02364 | 4.0e-97 | 1 | 165 | 165 | + L-ascorbate peroxidase 1 |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF22246.1 | 0 | 1 | 165 | 1 | 165 | ascorbate peroxidase [Pimpinella brachycarpa] |
GenBank | AAP42501.1 | 0 | 1 | 165 | 1 | 165 | ascorbate peroxidase [Ipomoea batatas] |
GenBank | ABS01350.1 | 0 | 1 | 165 | 1 | 165 | ascorbate peroxidase [Carica papaya] |
GenBank | ACM17464.1 | 0 | 1 | 165 | 1 | 165 | ascorbate peroxidase 2 [Citrus maxima] |
EMBL | CAD33265.1 | 0 | 1 | 165 | 1 | 165 | ascorbate peroxidase [Crocus sativus] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 3 | 168 | 2 | 167 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 3 | 168 | 2 | 167 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 3 | 168 | 2 | 167 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 3 | 168 | 2 | 167 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 0 | 3 | 168 | 2 | 167 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DC890166 | 165 | 1 | 165 | 0 |
FC869872 | 165 | 1 | 165 | 0 |
DN620200 | 165 | 1 | 165 | 0 |
FC870096 | 165 | 1 | 165 | 0 |
CN182780 | 165 | 1 | 165 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|