Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g031484m |
Family | GT28 |
Protein Properties | Length: 160 Molecular Weight: 17560.3 Isoelectric Point: 4.5579 |
Chromosome | Chromosome/Scaffold: 00228 Start: 156098 End: 159127 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT28 | 12 | 144 | 4.39999e-40 |
KHNLFIIWQTGVEAFNEMESLVRNHPRLLLTPFLHSMDLAYAAADLIVSRAGAMTCYEILATGKPSILIPSPNVAEGHQFKNASLMAKLADSRIITEDEL DSITLETTIEEILGNEALMAEMSERALKAAKPG |
Full Sequence |
---|
Protein Sequence Length: 160 Download |
MLNLYYQMLM EKHNLFIIWQ TGVEAFNEME SLVRNHPRLL LTPFLHSMDL AYAAADLIVS 60 RAGAMTCYEI LATGKPSILI PSPNVAEGHQ FKNASLMAKL ADSRIITEDE LDSITLETTI 120 EEILGNEALM AEMSERALKA AKPGASADIA QHILSLVES* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam04101 | Glyco_tran_28_C | 1.0e-25 | 9 | 149 | 143 | + Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site. |
TIGR01133 | murG | 3.0e-29 | 9 | 153 | 146 | + undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]. |
COG0707 | MurG | 5.0e-34 | 17 | 159 | 143 | + UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] |
PRK00726 | murG | 1.0e-44 | 17 | 159 | 143 | + undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional |
cd03785 | GT1_MurG | 8.0e-48 | 9 | 152 | 145 | + MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005975 | carbohydrate metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
GO:0030246 | carbohydrate binding |
GO:0030259 | lipid glycosylation |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI15500.1 | 0 | 1 | 158 | 273 | 430 | unnamed protein product [Vitis vinifera] |
GenBank | EEE54689.1 | 0 | 1 | 159 | 271 | 429 | hypothetical protein OsJ_01999 [Oryza sativa Japonica Group] |
RefSeq | XP_002277203.1 | 0 | 1 | 158 | 268 | 425 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002317900.1 | 0 | 1 | 159 | 241 | 399 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002524882.1 | 0 | 1 | 159 | 274 | 432 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3s2u_A | 0.000000000000009 | 41 | 159 | 239 | 357 | A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp |
PDB | 1nlm_B | 0.000000001 | 35 | 153 | 235 | 350 | A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp |
PDB | 1nlm_A | 0.000000001 | 35 | 153 | 235 | 350 | A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp |
PDB | 1f0k_B | 0.000000001 | 35 | 153 | 235 | 350 | A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg |
PDB | 1f0k_A | 0.000000001 | 35 | 153 | 235 | 350 | A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CF349877 | 157 | 1 | 157 | 0 |
CV232900 | 159 | 1 | 159 | 0 |
DT482425 | 159 | 1 | 159 | 0 |
FD490352 | 156 | 1 | 156 | 0 |
AW187929 | 158 | 1 | 158 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |