Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g031886m |
Family | AA6 |
Protein Properties | Length: 152 Molecular Weight: 16290.6 Isoelectric Point: 9.0462 |
Chromosome | Chromosome/Scaffold: 00026 Start: 543716 End: 544566 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 2 | 148 | 0 |
KAPPKTNDVPVIRPHQLKEADGFLFGFPSRFGVMAAQCKAFFDATYELWASQALAGKPAGIFWSTGFHGGGQELTALTAVTQLAHHGMLFVPLGYTFGSG MFEMNEVKGGSSYGAGTFAADGSRQPTDLELQQAFHQGKYVAEIAKK |
Full Sequence |
---|
Protein Sequence Length: 152 Download |
MKAPPKTNDV PVIRPHQLKE ADGFLFGFPS RFGVMAAQCK AFFDATYELW ASQALAGKPA 60 GIFWSTGFHG GGQELTALTA VTQLAHHGML FVPLGYTFGS GMFEMNEVKG GSSYGAGTFA 120 ADGSRQPTDL ELQQAFHQGK YVAEIAKKLK R* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam00258 | Flavodoxin_1 | 0.0003 | 18 | 88 | 77 | + Flavodoxin. |
pfam03358 | FMN_red | 2.0e-9 | 17 | 96 | 80 | + NADPH-dependent FMN reductase. |
COG0655 | WrbA | 2.0e-30 | 16 | 151 | 137 | + Multimeric flavodoxin WrbA [General function prediction only] |
TIGR01755 | flav_wrbA | 2.0e-43 | 10 | 149 | 141 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
PRK03767 | PRK03767 | 7.0e-52 | 11 | 151 | 142 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK23874.1 | 0 | 1 | 150 | 52 | 200 | unknown [Picea sitchensis] |
RefSeq | NP_200688.2 | 0 | 1 | 151 | 53 | 203 | quinone reductase family protein [Arabidopsis thaliana] |
RefSeq | XP_002279688.1 | 0 | 1 | 150 | 53 | 202 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002314113.1 | 0 | 1 | 150 | 53 | 202 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002525624.1 | 0 | 1 | 150 | 53 | 202 | Flavoprotein wrbA, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 1e-39 | 2 | 150 | 50 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 1e-39 | 2 | 150 | 50 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 1e-39 | 2 | 150 | 50 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_A | 1e-39 | 2 | 150 | 50 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6j_B | 1e-39 | 2 | 150 | 50 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DN619291 | 152 | 1 | 152 | 0 |
CX289758 | 152 | 1 | 152 | 0 |
CX047437 | 152 | 1 | 152 | 0 |
CX047438 | 152 | 1 | 152 | 0 |
EX447928 | 146 | 1 | 146 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |