Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g032687m |
Family | GH19 |
Protein Properties | Length: 137 Molecular Weight: 15242.3 Isoelectric Point: 8.5492 |
Chromosome | Chromosome/Scaffold: 00364 Start: 24181 End: 26233 |
Description | homolog of carrot EP3-3 chitinase |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 3 | 136 | 0 |
NLCYVEEINKYNRYCDEQNQQYPCVPGKFYYGRGPIQLTGNGDYGAAGKAIGFDGLRAPETVARDPVVSFKTALWFWMTYVHPVMNQGFGATIQRINGAI ECGGKQPAQVQARNGYYKDYCNKFGVAPGPNLYC |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
MRNLCYVEEI NKYNRYCDEQ NQQYPCVPGK FYYGRGPIQL TGNGDYGAAG KAIGFDGLRA 60 PETVARDPVV SFKTALWFWM TYVHPVMNQG FGATIQRING AIECGGKQPA QVQARNGYYK 120 DYCNKFGVAP GPNLYC* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
COG3179 | COG3179 | 2.0e-7 | 29 | 101 | 75 | + Predicted chitinase [General function prediction only] |
cd00442 | lysozyme_like | 4.0e-10 | 25 | 102 | 78 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. |
pfam00182 | Glyco_hydro_19 | 5.0e-59 | 2 | 136 | 156 | + Chitinase class I. |
cd00325 | chitinase_glyco_hydro_19 | 1.0e-63 | 4 | 136 | 154 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC35981.1 | 0 | 3 | 136 | 98 | 231 | chitinase CHI1 [Citrus sinensis] |
GenBank | ACD69683.1 | 0 | 3 | 125 | 118 | 240 | chitinase [Mangifera indica] |
GenBank | ACZ52964.1 | 0 | 3 | 136 | 94 | 227 | chitinase [Dimocarpus longan] |
RefSeq | NP_001053184.1 | 0 | 3 | 136 | 95 | 229 | Os04g0493400 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002339637.1 | 0 | 4 | 136 | 1 | 134 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 1e-39 | 4 | 136 | 70 | 204 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
PDB | 3hbe_X | 1e-39 | 4 | 136 | 70 | 204 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
PDB | 3hbd_A | 1e-39 | 4 | 136 | 70 | 204 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 2z37_D | 8e-39 | 5 | 136 | 85 | 237 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
PDB | 2z37_C | 8e-39 | 5 | 136 | 85 | 237 | A Chain A, Crystal Structure Of Brassica Juncea Chitinase Catalytic Module (Bjchi3) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX446356 | 135 | 3 | 137 | 0 |
CF835722 | 135 | 3 | 137 | 0 |
CX663308 | 135 | 3 | 137 | 0 |
CX640593 | 135 | 3 | 137 | 0 |
CX640594 | 135 | 3 | 137 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |