| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g035557m |
| Family | GT1 |
| Protein Properties | Length: 130 Molecular Weight: 14303.2 Isoelectric Point: 7.307 |
| Chromosome | Chromosome/Scaffold: 00860 Start: 5 End: 394 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 2 | 95 | 1.6e-29 |
| WCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERCKEIRQNA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 130 Download |
| NWCPQLEVLA HEATGCFLTH CGWNSTMEAR SLGVPMVAMP QWTDQSTNSK CVMDVWKTGL 60 KVPADDKGIV RREAIAHCIR EILEGERCKE IRQNAGKWSN FAKEAVTKGG SSDKNIDDFV 120 ANSISSKSF* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02210 | PLN02210 | 1.0e-30 | 2 | 122 | 122 | + UDP-glucosyl transferase | ||
| PLN02448 | PLN02448 | 6.0e-38 | 2 | 120 | 123 | + UDP-glycosyltransferase family protein | ||
| PLN02152 | PLN02152 | 2.0e-42 | 1 | 120 | 120 | + indole-3-acetate beta-glucosyltransferase | ||
| PLN02555 | PLN02555 | 3.0e-47 | 2 | 120 | 121 | + limonoid glucosyltransferase | ||
| PLN02173 | PLN02173 | 4.0e-53 | 2 | 121 | 121 | + UDP-glucosyl transferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACS87993.1 | 0 | 1 | 129 | 340 | 468 | UDP-glucosyltransferase family 1 protein [Citrus sinensis] |
| EMBL | CAN67246.1 | 0 | 1 | 126 | 306 | 431 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI24722.1 | 0 | 1 | 126 | 304 | 429 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002275333.1 | 0 | 1 | 121 | 329 | 449 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002320558.1 | 0 | 2 | 128 | 331 | 457 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2vg8_A | 3e-24 | 2 | 114 | 346 | 458 | A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag |
| PDB | 2vch_A | 3e-24 | 2 | 114 | 346 | 458 | A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag |
| PDB | 2vce_A | 3e-24 | 2 | 114 | 346 | 458 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 2pq6_A | 8e-24 | 1 | 122 | 359 | 476 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2c9z_A | 5e-23 | 2 | 120 | 332 | 447 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CB304827 | 130 | 1 | 130 | 0 |
| CN187373 | 130 | 1 | 130 | 0 |
| CB290310 | 130 | 1 | 130 | 0 |
| CN190071 | 130 | 1 | 130 | 0 |
| CB291952 | 130 | 1 | 130 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
