y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g036262m
FamilyGH28
Protein PropertiesLength: 196 Molecular Weight: 20864.6 Isoelectric Point: 5.2802
ChromosomeChromosome/Scaffold: 08488 Start: 1895 End: 2596
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2821840
  RSNGIEISNSIIATGDDCVSLGDGSQNVLVSDVSCGPGHGISVGSLGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVEN
  PIVIDQEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPT
Full Sequence
Protein Sequence     Length: 196     Download
GRSNGIEISN SIIATGDDCV SLGDGSQNVL VSDVSCGPGH GISVGSLGKY KKEEDVVGLT    60
VINCTFTGTS NGVRIKTWPD SEDGKASNFT FEDLFMNNVE NPIVIDQEYC PHNQCNIKVP    120
SRVKISNVRF RNIRGTSLTK EAVRIVCSKE IPCQNVEIGD INLVYNGIDD KGPAISSCSN    180
VKPTLVGKQI PATCV*                                                    240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02218PLN022184.0e-443163161+
PLN02793PLN027934.0e-493167166+
PLN02155PLN021552.0e-533195194+
pfam00295Glyco_hydro_284.0e-621182182+
PLN02188PLN021888.0e-762194194+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002269648.101195172364PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002274125.101195203395PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282563.101195203395PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282573.101194203394PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282594.101194203394PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nhc_F0.00000000052181160330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_E0.00000000052181160330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_D0.00000000052181160330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_C0.00000000052181160330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_B0.00000000052181160330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CU61766519411940
FD98547819511940
CO11524119411940
CO12228419411940
GR45805919511940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00345.1Aquca_014_00346.1Aquca_017_00129.1Aquca_007_00950.1Aquca_001_00543.1
Aquca_017_00127.1Aquca_017_00128.2Aquca_017_00128.1Aquca_005_00082.1Aquca_005_00081.1
Aquca_019_00042.1Aquca_019_00045.1Aquca_003_00665.1Aquca_012_00088.1Aquca_017_00128.3
Aquca_016_00178.1Aquca_035_00221.1Aquca_023_00138.1Aquca_023_00144.1Aquca_013_00893.1
Aquca_019_00043.1
Arabidopsis lyrata887420329713497387318190478122
478120494865478121870890877955
894135486450483504903793903792
887757887756902380471917882030
863554870473870469
Arabidopsis thalianaAT1G02790.1AT4G18180.1AT3G14040.1AT3G07850.1AT5G48140.1
AT3G07820.1AT3G07830.1AT3G07840.1AT1G78400.1AT2G43860.1
AT2G15460.1AT1G65570.1AT3G59850.1AT2G43870.1AT2G43890.1
AT1G05660.1AT2G43880.1AT1G05650.1AT2G33160.1AT1G17150.1
AT2G15450.1AT1G43090.1AT1G43080.1AT1G43100.1AT2G15470.1
AT2G40310.1AT4G13760.1AT2G26620.1
Brachypodium distachyonBradi1g36100.1Bradi2g13740.1Bradi3g20537.1Bradi3g42120.1Bradi3g07120.1
Bradi2g57427.1Bradi1g36110.1Bradi1g36090.1Bradi1g40990.1
Brassica rapaBra010872Bra010873Bra032585Bra033347Bra012613
Bra030510Bra001270Bra040032Bra001268Bra035034
Bra029682Bra037431Bra020716Bra037509Bra040035
Bra040034Bra001269Bra029683Bra025997Bra004119
Bra040790Bra007483Bra000332Bra037678Bra000331
Bra004791Bra037676Bra004789Bra037677Bra030619
Bra015446Bra004790Bra021830Bra022928Bra000183
Bra000645Bra014753Bra004111Bra017014Bra037680.252.476
Bra037680.252.476Bra015210Bra000327Bra037680.58.254Bra037680.58.254
Bra037679
Carica papayaevm.model.supercontig_151.22evm.model.supercontig_12.214evm.model.supercontig_50.155evm.model.supercontig_48.188evm.model.supercontig_1615.1
evm.model.supercontig_64.7evm.model.supercontig_64.6evm.model.supercontig_250.6evm.model.supercontig_250.7evm.model.supercontig_14.219
evm.model.supercontig_250.4evm.model.supercontig_250.3evm.model.supercontig_48.187evm.model.supercontig_136.8evm.model.supercontig_333.3
Capsella rubellaCarubv10012094mCarubv10006680mCarubv10015686mCarubv10027711mCarubv10015950m
Carubv10015428mCarubv10015541mCarubv10021845mCarubv10025146mCarubv10007695m
Carubv10022424mCarubv10017416mCarubv10024765mCarubv10025465mCarubv10024902m
Carubv10024718mCarubv10011292mCarubv10012375mCarubv10024590mCarubv10024886m
Carubv10022383mCarubv10012276mCarubv10016541mCarubv10011686m
Citrus clementinaCiclev10023712mCiclev10004345m.90.360Ciclev10004345m.90.360Ciclev10023493mCiclev10015423m
Ciclev10004345m.455.780Ciclev10004345m.455.780Ciclev10017883mCiclev10006970m
Citrus sinensisorange1.1g039959morange1.1g043757morange1.1g047315morange1.1g015254morange1.1g045893m
orange1.1g042768morange1.1g043588morange1.1g048431morange1.1g045402morange1.1g041993m
orange1.1g041973morange1.1g046411morange1.1g037377morange1.1g036371morange1.1g047296m
orange1.1g047322morange1.1g027251morange1.1g027435morange1.1g040962m
Cucumis sativusCucsa.252840.1Cucsa.205370.1Cucsa.205400.1Cucsa.205410.1Cucsa.388450.1
Cucsa.099870.1Cucsa.099870.2Cucsa.100520.1Cucsa.295580.1Cucsa.124080.1
Cucsa.277280.1Cucsa.357430.1Cucsa.252830.1Cucsa.086360.1Cucsa.237900.1
Cucsa.167020.1Cucsa.181040.1Cucsa.042430.1Cucsa.180960.1Cucsa.100530.1
Cucsa.143900.1Cucsa.056540.1Cucsa.138430.1Cucsa.027780.1Cucsa.138440.1
Cucsa.150180.1Cucsa.033910.1Cucsa.114180.1Cucsa.034590.1Cucsa.291530.1
Cucsa.356350.1Cucsa.042440.1Cucsa.071480.1Cucsa.181130.1Cucsa.205390.1
Eucalyptus grandisEucgr.H01890.1Eucgr.H01889.1Eucgr.L02033.1Eucgr.H01088.1Eucgr.B01575.1
Eucgr.K00666.1Eucgr.L01551.1Eucgr.K00665.1Eucgr.L01230.1Eucgr.L03464.1
Eucgr.L03153.1Eucgr.K00662.1Eucgr.A01068.1Eucgr.A01065.1Eucgr.C02251.1
Eucgr.K00664.1Eucgr.C02249.1Eucgr.H03964.1Eucgr.K00661.1Eucgr.H00254.1
Eucgr.L01949.1Eucgr.L01371.1Eucgr.H00252.1Eucgr.L00823.1Eucgr.H00255.1
Eucgr.H00253.1Eucgr.J01077.1Eucgr.H00250.1Eucgr.H01886.1Eucgr.A00432.1
Eucgr.L00826.1Eucgr.F00633.1Eucgr.F00632.1Eucgr.F00634.1Eucgr.H00251.1
Eucgr.L03486.1Eucgr.H05001.1
Fragaria vescamrna20228.1-v1.0-hybridmrna07055.1-v1.0-hybridmrna11078.1-v1.0-hybridmrna17351.1-v1.0-hybridmrna27787.1-v1.0-hybrid
mrna14305.1-v1.0-hybridmrna21632.1-v1.0-hybridmrna23948.1-v1.0-hybridmrna01127.1-v1.0-hybridmrna21638.1-v1.0-hybrid
mrna01445.1-v1.0-hybridmrna04439.1-v1.0-hybridmrna19487.1-v1.0-hybrid.66.392mrna19487.1-v1.0-hybrid.66.392mrna02341.1-v1.0-hybrid
mrna19487.1-v1.0-hybrid.453.786mrna19487.1-v1.0-hybrid.453.786mrna03511.1-v1.0-hybridmrna17837.1-v1.0-hybridmrna10145.1-v1.0-hybrid
mrna31694.1-v1.0-hybridmrna31695.1-v1.0-hybridmrna31696.1-v1.0-hybridmrna10147.1-v1.0-hybridmrna21420.1-v1.0-hybrid
mrna10146.1-v1.0-hybridmrna07354.1-v1.0-hybridmrna14928.1-v1.0-hybridmrna21640.1-v1.0-hybridmrna20575.1-v1.0-hybrid
mrna14927.1-v1.0-hybridmrna04504.1-v1.0-hybridmrna23301.1-v1.0-hybrid
Glycine maxGlyma15g16240.2Glyma09g04640.2Glyma02g01980.1Glyma07g37440.1Glyma14g00930.2
Glyma14g00930.1Glyma06g22890.1Glyma04g30870.1Glyma04g30920.2Glyma04g30950.1
Glyma18g22430.1Glyma14g37030.1Glyma06g22030.1Glyma02g47720.1Glyma08g15840.1
Glyma03g24030.1Glyma20g02840.1Glyma15g13360.1Glyma09g02460.2Glyma07g34990.2
Glyma01g18520.1Glyma15g23310.1Glyma09g10500.1Glyma10g02120.2Glyma15g42420.2
Glyma15g16251.1Glyma02g38980.2
Gossypium raimondiiGorai.011G222300.1Gorai.005G061900.1Gorai.006G260500.1Gorai.006G076800.1Gorai.006G260500.2
Gorai.007G167600.1Gorai.001G193800.1Gorai.010G091200.1Gorai.006G016500.1Gorai.011G193300.1
Gorai.008G013400.1Gorai.002G038500.1Gorai.002G056900.1Gorai.013G003900.1Gorai.013G004900.1
Gorai.013G004100.1Gorai.011G222200.1Gorai.013G004800.1Gorai.011G222400.1Gorai.012G120000.1
Gorai.006G186600.1Gorai.013G004000.1Gorai.001G098100.1Gorai.002G057100.1Gorai.008G013400.3
Gorai.008G013400.2
Linum usitatissimumLus10016823Lus10003782Lus10012489Lus10039154Lus10009606
Lus10016824Lus10009605Lus10013784Lus10013780Lus10041059
Lus10041058Lus10043088Lus10003001Lus10002123Lus10011419
Lus10002125Lus10011418Lus10002124Lus10002126Lus10022530
Lus10010584Lus10008343Lus10005304Lus10026183Lus10042483
Lus10043087Lus10026184Lus10011417Lus10006167
Malus domesticaMDP0000498407MDP0000261960MDP0000221383MDP0000582836MDP0000261959
MDP0000263137MDP0000286230MDP0000223959MDP0000307094MDP0000859246
MDP0000247298MDP0000524522MDP0000432773MDP0000230434MDP0000163058
MDP0000263272MDP0000235201MDP0000190165MDP0000853065MDP0000516623
MDP0000524876MDP0000845685MDP0000615684MDP0000191453MDP0000169108
MDP0000273194MDP0000260203MDP0000845683MDP0000176123MDP0000247300
MDP0000447149
Manihot esculentacassava4.1_032966mcassava4.1_027290mcassava4.1_029456mcassava4.1_033867mcassava4.1_031726m
cassava4.1_031743mcassava4.1_026629mcassava4.1_027590mcassava4.1_027889mcassava4.1_031143m
cassava4.1_025978mcassava4.1_027894mcassava4.1_026609mcassava4.1_026297mcassava4.1_030897m
cassava4.1_022005mcassava4.1_030943mcassava4.1_031277mcassava4.1_033821mcassava4.1_025673m
cassava4.1_026560mcassava4.1_025157mcassava4.1_021864mcassava4.1_021791mcassava4.1_030301m
cassava4.1_028376mcassava4.1_023138mcassava4.1_020879mcassava4.1_032576mcassava4.1_028825m
cassava4.1_026411mcassava4.1_030991mcassava4.1_030858mcassava4.1_027487mcassava4.1_024357m
cassava4.1_034065mcassava4.1_029037mcassava4.1_029297m
Medicago truncatulaMedtr1g088160.1Medtr2g058840.1Medtr2g058670.1Medtr2g058640.1Medtr4g083660.1
Medtr2g029170.1Medtr2g049400.1Medtr5g097860.1Medtr5g063430.1
Mimulus guttatusmgv1a007314mmgv1a026431mmgv1a007104mmgv1a020057mmgv1a019884m
mgv1a023133mmgv1a007528mmgv1a007545mmgv1a007538mmgv1a007536m
mgv1a007533mmgv1a007768mmgv1a023860mmgv1a023303mmgv1a025544m
mgv1a018101mmgv1a021627mmgv1a019967mmgv1a023780mmgv1a025431m
mgv1a022372mmgv1a017666mmgv1a023900mmgv1a008791mmgv1a012335m
Oryza sativaLOC_Os06g31270.1LOC_Os01g33300.1LOC_Os06g40880.1LOC_Os06g35370.1LOC_Os06g35320.1
LOC_Os06g40890.1LOC_Os02g10300.1LOC_Os01g43490.1LOC_Os01g66710.1LOC_Os11g14410.1
LOC_Os08g23790.1LOC_Os06g35300.1LOC_Os11g14400.1
Panicum virgatumPavirv00035134mPavirv00034360mPavirv00055614mPavirv00040368mPavirv00022526m
Pavirv00010684mPavirv00044011mPavirv00046761mPavirv00005355mPavirv00005092m
Pavirv00069057mPavirv00058217mPavirv00024858mPavirv00015323mPavirv00028286m
Pavirv00007502mPavirv00035135mPavirv00034359mPavirv00042409mPavirv00018555m
Phaseolus vulgarisPhvul.003G107500.1Phvul.009G251500.1Phvul.007G218300.1Phvul.008G286900.1Phvul.004G097300.1
Phvul.007G076900.1Phvul.007G077000.1Phvul.002G100400.1Phvul.008G143500.1Phvul.010G039000.1
Phvul.007G076800.1Phvul.007G076600.1Phvul.005G039700.1Phvul.007G076400.1
Picea abiesMA_13282g0010
Populus trichocarpaPotri.010G007300.1Potri.010G011100.1Potri.010G011200.1Potri.002G202100.1Potri.002G202200.1
Potri.009G169100.1Potri.009G038100.1Potri.019G067200.1Potri.019G067100.1Potri.019G067000.1
Potri.019G066800.1Potri.019G066700.1Potri.014G162300.1Potri.007G035800.1Potri.T177500.1
Potri.T170900.1Potri.010G177600.1Potri.T171000.1Potri.010G248200.1Potri.017G004500.1
Potri.017G003500.1Potri.007G144200.1Potri.007G144400.1Potri.017G005300.1Potri.017G005600.1
Potri.017G005900.1Potri.007G144100.1Potri.T075100.1Potri.007G144500.1Potri.008G010700.1
Potri.017G006200.1Potri.017G005800.1Potri.017G004700.1Potri.017G006700.1Potri.007G145300.1
Potri.017G006500.1Potri.017G006400.1Potri.007G144400.2Potri.019G066800.2Potri.001G377700.1
Prunus persicappa018682mppa016722mppa026115mppa015208mppa015568m
ppa019563mppa018308mppa025464mppa021953mppa007271m
ppa025787mppa006839mppa006857mppa025098mppa016502m
ppa018149mppa020072mppa017135m
Ricinus communis29726.m00409029769.m0046629986.m00164929769.m00046130042.m000469
29738.m00100530042.m00046830042.m00047030042.m00046730042.m000474
30042.m00047530042.m00047630042.m00047230042.m000473
Setaria italicaSi007823mSi015137mSi015477mSi004860mSi017418m
Si006535mSi004836mSi005178mSi006532mSi028218m
Si039581mSi008011m
Sorghum bicolorSb10g024020.1Sb07g016970.1Sb04g006610.1Sb07g025130.1Sb03g021050.1
Sb10g003580.1Sb03g042350.1Sb03g028380.1Sb10g024010.1Sb10g021590.1
Sb10g024000.1
Thellungiella halophilaThhalv10007721mThhalv10027030mThhalv10020501mThhalv10004361mThhalv10020916m
Thhalv10020872mThhalv10005587mThhalv10020866mThhalv10018650mThhalv10001794m
Thhalv10018672mThhalv10006416mThhalv10001491mThhalv10001486mThhalv10001483m
Thhalv10001484mThhalv10007830mThhalv10028169mThhalv10017763mThhalv10027416m
Thhalv10009641mThhalv10017738mThhalv10009339m
Vitis viniferaGSVIVT01035103001GSVIVT01028044001GSVIVT01035102001GSVIVT01030023001GSVIVT01030017001
GSVIVT01020792001GSVIVT01020794001GSVIVT01012232001GSVIVT01030018001GSVIVT01030030001
GSVIVT01004006001GSVIVT01004007001GSVIVT01038241001GSVIVT01038243001GSVIVT01006443001
GSVIVT01023861001.76.261GSVIVT01023861001.76.261GSVIVT01020791001GSVIVT01030031001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)