| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g039046m |
| Family | GH17 |
| Protein Properties | Length: 93 Molecular Weight: 10614 Isoelectric Point: 6.8031 |
| Chromosome | Chromosome/Scaffold: 01990 Start: 15120 End: 15728 |
| Description | beta-1,3-glucanase 3 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 9 | 91 | 1.7e-27 |
| FVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| MHVGARWIFV ISESEWLAAG GDRLLMNVDN ARTYNNNLIQ HVKEGSPKKP GKPIETFIFA 60 IFDENDKQGV EIERHWGLFA PDKQPKYQVN FN* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 8.0e-39 | 4 | 91 | 89 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAY40462.1 | 2e-36 | 3 | 92 | 249 | 336 | beta-1,3-glucanase class III [Citrus clementina x Citrus reticulata] |
| GenBank | ABK58141.1 | 3e-32 | 4 | 92 | 223 | 309 | beta-1,3-glucanase [Manihot esculenta] |
| GenBank | ABQ45848.1 | 3e-38 | 4 | 92 | 250 | 337 | beta-1,3-glucanase [Citrus unshiu] |
| GenBank | ACD45060.1 | 5e-31 | 10 | 92 | 266 | 345 | beta-1,3-glucanase [Vitis riparia] |
| EMBL | CAA03908.1 | 4.99997e-41 | 4 | 92 | 248 | 336 | beta-1,3-glucanase [Citrus sinensis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ur8_B | 5e-25 | 10 | 92 | 233 | 315 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
| PDB | 3ur8_A | 5e-25 | 10 | 92 | 233 | 315 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
| PDB | 3ur7_B | 5e-25 | 10 | 92 | 233 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 5e-25 | 10 | 92 | 233 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 4gzj_A | 3e-24 | 10 | 92 | 233 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CX292665 | 90 | 4 | 93 | 1.4013e-45 |
| CX298402 | 90 | 4 | 93 | 1.4013e-45 |
| CN192291 | 90 | 4 | 93 | 1.4013e-45 |
| CN192421 | 90 | 4 | 93 | 2.8026e-45 |
| CN192309 | 90 | 4 | 93 | 2.8026e-45 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |