Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g039834m |
Family | CBM43 |
Protein Properties | Length: 101 Molecular Weight: 10655.7 Isoelectric Point: 4.3598 |
Chromosome | Chromosome/Scaffold: 00007 Start: 1410867 End: 1411416 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 11 | 92 | 6.2e-32 |
WCVAKPATSDQLLQSNIDFACQKVDCSPIKSGGACFDPNTPMHHASFAMNLYYQNNGKTAASCDFNNSGLIVAANDPSFGSC |
Full Sequence |
---|
Protein Sequence Length: 101 Download |
GNAEVDTERT WCVAKPATSD QLLQSNIDFA CQKVDCSPIK SGGACFDPNT PMHHASFAMN 60 LYYQNNGKTA ASCDFNNSGL IVAANDPSFG SCTYPGPEQT * |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 7.0e-20 | 10 | 79 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 9.0e-33 | 10 | 94 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG36169.1 | 8e-27 | 5 | 94 | 20 | 108 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | NP_001042566.1 | 7e-27 | 6 | 94 | 33 | 120 | Os01g0243700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_200172.1 | 4e-27 | 5 | 94 | 23 | 111 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002519722.1 | 1e-31 | 3 | 94 | 126 | 216 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 2e-28 | 6 | 94 | 27 | 114 | hypothetical protein RCOM_0633850 [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-25 | 10 | 95 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE256344 | 92 | 3 | 94 | 1e-31 |
EE255611 | 92 | 3 | 94 | 8e-31 |
DK950175 | 95 | 2 | 94 | 2e-28 |
EE255611 | 89 | 6 | 94 | 9e-28 |
EE256344 | 52 | 43 | 94 | 0.000000000006 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|