y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g040317m
FamilyGH28
Protein PropertiesLength: 126 Molecular Weight: 13951.7 Isoelectric Point: 8.501
ChromosomeChromosome/Scaffold: 00180 Start: 173055 End: 173583
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2821197.3e-31
  AINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNII
  MNDIQNPIIIDRNYCSYN
Full Sequence
Protein Sequence     Length: 126     Download
MAINHCSDIL IRNVKIIDPT NSPTTDGIQM QSSTGVTITS SSIMTGEPFV NRLGDHLNEE    60
GVQNVTVTSS SFTNTQNGVR IKLWARPRNG YARNIAFRNI IMNDIQNPII IDRNYCSYNR    120
GCPHQ*                                                               180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02188PLN021885.0e-51125150+
PLN02155PLN021551.0e-171125149+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_172056.13e-391125171319polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana]
RefSeqNP_172057.12e-381125171319polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana]
RefSeqNP_181916.13e-401125174322polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana]
RefSeqXP_002331633.17.00005e-411125170318predicted protein [Populus trichocarpa]
RefSeqXP_002331634.14e-391125170318predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bhe_A0.0000316115192314A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1czf_B0.00314115190291A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger
PDB1czf_A0.00314115190291A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger
PDB1nhc_F0.0065115134265A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_E0.0065115134265A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX70111114911250.00000000004
EY13460114911250.00000000005
EY13460214911250.00000000006
EY90950914911250.00000000006
CO90359014911250.00000000007
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_1124.1
Cucumis sativusCucsa.356360.1Cucsa.038070.1
Malus domesticaMDP0000246436MDP0000512850
Manihot esculentacassava4.1_028563mcassava4.1_022514mcassava4.1_029929m
Populus trichocarpaPotri.017G006300.1
Ricinus communis30042.m00046630042.m000471
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny