| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g040317m |
| Family | GH28 |
| Protein Properties | Length: 126 Molecular Weight: 13951.7 Isoelectric Point: 8.501 |
| Chromosome | Chromosome/Scaffold: 00180 Start: 173055 End: 173583 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 2 | 119 | 7.3e-31 |
| AINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNII MNDIQNPIIIDRNYCSYN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 126 Download |
| MAINHCSDIL IRNVKIIDPT NSPTTDGIQM QSSTGVTITS SSIMTGEPFV NRLGDHLNEE 60 GVQNVTVTSS SFTNTQNGVR IKLWARPRNG YARNIAFRNI IMNDIQNPII IDRNYCSYNR 120 GCPHQ* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02188 | PLN02188 | 5.0e-5 | 1 | 125 | 150 | + polygalacturonase/glycoside hydrolase family protein | ||
| PLN02155 | PLN02155 | 1.0e-17 | 1 | 125 | 149 | + polygalacturonase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_172056.1 | 3e-39 | 1 | 125 | 171 | 319 | polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana] |
| RefSeq | NP_172057.1 | 2e-38 | 1 | 125 | 171 | 319 | polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana] |
| RefSeq | NP_181916.1 | 3e-40 | 1 | 125 | 174 | 322 | polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana] |
| RefSeq | XP_002331633.1 | 7.00005e-41 | 1 | 125 | 170 | 318 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002331634.1 | 4e-39 | 1 | 125 | 170 | 318 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1bhe_A | 0.00003 | 16 | 115 | 192 | 314 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 1czf_B | 0.003 | 14 | 115 | 190 | 291 | A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger |
| PDB | 1czf_A | 0.003 | 14 | 115 | 190 | 291 | A Chain A, Endo-Polygalacturonase Ii From Aspergillus Niger |
| PDB | 1nhc_F | 0.006 | 5 | 115 | 134 | 265 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.006 | 5 | 115 | 134 | 265 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CX701111 | 149 | 1 | 125 | 0.00000000004 |
| EY134601 | 149 | 1 | 125 | 0.00000000005 |
| EY134602 | 149 | 1 | 125 | 0.00000000006 |
| EY909509 | 149 | 1 | 125 | 0.00000000006 |
| CO903590 | 149 | 1 | 125 | 0.00000000007 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |