y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g041616m
FamilyPL1
Protein PropertiesLength: 203 Molecular Weight: 23697.4 Isoelectric Point: 10.6421
ChromosomeChromosome/Scaffold: 00105 Start: 125015 End: 126454
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1491641.3e-39
  NITLHKLRKIDRDAIRLVIALKVWIDHNTLYKCQNGLIDVTRGSTDVTISNNWFRNQDKIKLLGHDDGYIRDKNMKMTIAYNHFGRNCNQRMPRVRHGFA
  HVINNLYRKWTQYTIG
Full Sequence
Protein Sequence     Length: 203     Download
MTNNVGKDVV RYKVTDPGDD TINPKPGTLR YEAILIPQKV WTTYRKHMNI TLHKLRKIDR    60
DAIRLVIALK VWIDHNTLYK CQNGLIDVTR GSTDVTISNN WFRNQDKIKL LGHDDGYIRD    120
KNMKMTIAYN HFGRNCNQRM PRVRHGFAHV INNLYRKWTQ YTIGKANLKY TEEQKCQVAN    180
AKSMRSLTSE LRVSKCSRRS RC*                                            240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-2049172140+
pfam00544Pec_lyase_C2.0e-3459164114+
smart00656Amb_all9.0e-3949164128+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.1011881249unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.10118850298PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002304865.10116632257predicted protein [Populus trichocarpa]
RefSeqXP_002458626.10117455288hypothetical protein SORBIDRAFT_03g036930 [Sorghum bicolor]
RefSeqXP_002527354.10116660285Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B5e-3649202139291A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A5e-3649202139291A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A0.0000000000000756155112213A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A0.00000000000159156188302A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3vmw_A0.000000000249156109224A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT575750109581660
FG470156135591920
FG468822135591920
FG468635135591920
FG468869108591660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma16g25710.2Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny