Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g042066m |
Family | GT43 |
Protein Properties | Length: 148 Molecular Weight: 16730 Isoelectric Point: 7.7378 |
Chromosome | Chromosome/Scaffold: 12565 Start: 1326 End: 1991 |
Description | Nucleotide-diphospho-sugar transferases superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT43 | 2 | 118 | 0 |
HQRNVALKHIEHHRLSGIVHFAGVSNVYDLAFFDELRDIEVYGAWPVALLSANKQKVIIEGPVCDSSQVIGWHLKKLNNETDAKPPIHVSSFAFNSSILW DPERWGRPSSVQQTSQV |
Full Sequence |
---|
Protein Sequence Length: 148 Download |
DHQRNVALKH IEHHRLSGIV HFAGVSNVYD LAFFDELRDI EVYGAWPVAL LSANKQKVII 60 EGPVCDSSQV IGWHLKKLNN ETDAKPPIHV SSFAFNSSIL WDPERWGRPS SVQQTSQVKT 120 PYLLRMFGYE CFSNTLGNHQ TNKVFIV* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam03360 | Glyco_transf_43 | 1.0e-35 | 1 | 131 | 144 | + Glycosyltransferase family 43. |
cd00218 | GlcAT-I | 6.0e-44 | 1 | 113 | 116 | + Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis. Beta1,3-glucuronyltransferase I (GlcAT-I) domain; GlcAT-I is a Key enzyme involved in the initial steps of proteoglycan synthesis. GlcAT-I catalyzes the transfer of a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region of trisaccharide Gal-beta-(1-3)-Gal-beta-(1-4)-Xyl of proteoglycans. The enzyme has two subdomains that bind the donor and acceptor substrate separately. The active site is located at the cleft between both subdomains in which the trisaccharide molecule is oriented perpendicular to the UDP. This family has been classified as Glycosyltransferase family 43 (GT-43). |
PLN02458 | PLN02458 | 2.0e-86 | 1 | 117 | 117 | + transferase, transferring glycosyl groups |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0015018 | galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity |
GO:0016020 | membrane |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAX33318.1 | 0 | 1 | 117 | 185 | 301 | secondary cell wall-related glycosyltransferase family 43 [Populus tremula x Populus tremuloides] |
GenBank | AAX33319.1 | 0 | 1 | 117 | 188 | 304 | secondary cell wall-related glycosyltransferase family 43 [Populus tremula x Populus tremuloides] |
EMBL | CAI93178.1 | 0 | 1 | 117 | 189 | 305 | glycosyltransferase [Populus balsamifera] |
RefSeq | XP_002323456.1 | 0 | 1 | 117 | 189 | 305 | glycosyl transferase [Populus trichocarpa] |
RefSeq | XP_002326337.1 | 0 | 1 | 117 | 185 | 301 | glycosyl transferase [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2d0j_D | 0.000005 | 2 | 74 | 81 | 154 | A Chain A, Crystal Structure Of Human Glcat-S Apo Form |
PDB | 2d0j_C | 0.000005 | 2 | 74 | 81 | 154 | A Chain A, Crystal Structure Of Human Glcat-S Apo Form |
PDB | 2d0j_B | 0.000005 | 2 | 74 | 81 | 154 | A Chain A, Crystal Structure Of Human Glcat-S Apo Form |
PDB | 2d0j_A | 0.000005 | 2 | 74 | 81 | 154 | A Chain A, Crystal Structure Of Human Glcat-S Apo Form |
PDB | 1kws_B | 0.0001 | 18 | 102 | 114 | 191 | A Chain A, Crystal Structure Of Human Glcat-S Apo Form |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EY685268 | 117 | 1 | 117 | 0 |
EY684777 | 117 | 1 | 117 | 0 |
CX641116 | 114 | 4 | 117 | 0 |
CX641115 | 114 | 4 | 117 | 0 |
BI127730 | 117 | 1 | 117 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |