y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g042417m
FamilyGH28
Protein PropertiesLength: 250 Molecular Weight: 26825.3 Isoelectric Point: 7.3366
ChromosomeChromosome/Scaffold: 00079 Start: 487551 End: 489884
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28461541.9e-30
  LSIRFNFLNDSTITGIKSVDSRYFHINILGCYNLKLNDLKITAHADSPNTEGIHIGSSNGSEISHSVIATGDDCVSLGHGISVGSLGKGINDEEVVGLTV
  RNCTFTGTN
Full Sequence
Protein Sequence     Length: 250     Download
VFNVKDFGAV ADGIKDDSKA FETAWREACN WDGIKSAVLV PPGKYLSIRF NFLNDSTITG    60
IKSVDSRYFH INILGCYNLK LNDLKITAHA DSPNTEGIHI GSSNGSEISH SVIATGDDCV    120
SLGHGISVGS LGKGINDEEV VGLTVRNCTF TGTNIVTNNV ENPIVIDQLY CPYNKCNIKV    180
PSQVKTSNVR FNNIRGTSAN KIPCQNIGIG NINWVYNGVN VKVEGPETTS LCSNVKPTLF    240
GKQIPATCV*                                                           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02155PLN021550.000614646+
PLN02188PLN021882.0e-825051+
PLN02155PLN021555.0e-3631249268+
pfam00295Glyco_hydro_286.0e-4631236250+
PLN02188PLN021881.0e-5747248252+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002269648.1046249117364PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002274125.1046249148395PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282573.1046248148394PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ib4_B0.00153201112261A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB1ib4_A0.00153201112261A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB1ia5_A0.00153201112261A Chain A, Polygalacturonase From Aspergillus Aculeatus
PDB1bhe_A0.00248178154322A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1nhc_F0.00953235108330A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT741125250462480
GR453460253462480
GR454433253462480
GR460755253462480
GR452025253462480
Orthologous Group
SpeciesID
Citrus clementinaCiclev10030302m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny