Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g042985m |
Family | CE10 |
Protein Properties | Length: 122 Molecular Weight: 13396.3 Isoelectric Point: 6.9524 |
Chromosome | Chromosome/Scaffold: 00062 Start: 641097 End: 641462 |
Description | carboxyesterase 20 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 21 | 121 | 5.8e-27 |
AATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKLPLIVYVHGGALILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDA L |
Full Sequence |
---|
Protein Sequence Length: 122 Download |
MFIVNADGTI TRDYSNYPST AATPDPNDHT IAVSKDVPVN QSNKTWVRIF LPRQALDSST 60 KTKLPLIVYV HGGALILLSA ATKIYHDLCS DIAARVPAVI VSVDYRLAPE HRLPAAYYDA 120 LE |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK10162 | PRK10162 | 4.0e-6 | 47 | 116 | 71 | + acetyl esterase; Provisional | ||
pfam00135 | COesterase | 3.0e-6 | 57 | 109 | 53 | + Carboxylesterase family. | ||
COG2272 | PnbA | 2.0e-7 | 61 | 122 | 62 | + Carboxylesterase type B [Lipid metabolism] | ||
COG0657 | Aes | 1.0e-14 | 47 | 120 | 74 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 2.0e-20 | 67 | 122 | 56 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016787 | hydrolase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABB89014.1 | 3e-36 | 3 | 122 | 6 | 126 | CXE carboxylesterase [Actinidia arguta] |
RefSeq | NP_201024.1 | 3e-39 | 5 | 122 | 19 | 138 | AtCXE20 (Arabidopsis thaliana carboxyesterase 20); carboxylesterase |
RefSeq | XP_002262620.1 | 1e-36 | 5 | 122 | 19 | 140 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002322442.1 | 2.94273e-44 | 2 | 122 | 21 | 142 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002510875.1 | 3e-38 | 1 | 122 | 17 | 140 | Gibberellin receptor GID1, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 1e-36 | 3 | 122 | 25 | 141 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2o7r_A | 1e-36 | 3 | 122 | 25 | 141 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_F | 0.000000000006 | 6 | 120 | 36 | 168 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_E | 0.000000000006 | 6 | 120 | 36 | 168 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_D | 0.000000000006 | 6 | 120 | 36 | 168 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FC893079 | 122 | 1 | 122 | 0 |
FC892509 | 122 | 1 | 122 | 0 |
FC878990 | 122 | 1 | 122 | 0 |
FC868990 | 122 | 1 | 122 | 0 |
DY295889 | 122 | 1 | 122 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|