| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g043973m |
| Family | GH9 |
| Protein Properties | Length: 125 Molecular Weight: 13600.4 Isoelectric Point: 9.7123 |
| Chromosome | Chromosome/Scaffold: 01407 Start: 6822 End: 8046 |
| Description | cellulase 3 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 16 | 116 | 9e-34 |
| KVDYILGVNPLKMSYMVGFGPNFSRRIHHRGSSLLSLANHPQSIRCDGGFEPFFHSSNPNILVGAIVGGPNQNDGFPDDRSDYSHSEPATYINAAMVGPL A | |||
| Full Sequence |
|---|
| Protein Sequence Length: 125 Download |
| MWNVIPRGKI RNKMYKVDYI LGVNPLKMSY MVGFGPNFSR RIHHRGSSLL SLANHPQSIR 60 CDGGFEPFFH SSNPNILVGA IVGGPNQNDG FPDDRSDYSH SEPATYINAA MVGPLAYFAG 120 GKSG* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02308 | PLN02308 | 8.0e-43 | 16 | 119 | 105 | + endoglucanase | ||
| pfam00759 | Glyco_hydro_9 | 3.0e-44 | 1 | 116 | 119 | + Glycosyl hydrolase family 9. | ||
| PLN02613 | PLN02613 | 3.0e-47 | 16 | 123 | 110 | + endoglucanase | ||
| PLN02266 | PLN02266 | 4.0e-51 | 4 | 119 | 118 | + endoglucanase | ||
| PLN02175 | PLN02175 | 1.0e-51 | 4 | 123 | 121 | + endoglucanase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB65156.1 | 0 | 16 | 124 | 378 | 488 | basic cellulase [Citrus sinensis] |
| GenBank | AAT75042.1 | 0 | 4 | 120 | 365 | 483 | Cel9B [Populus tremula x Populus tremuloides] |
| GenBank | ACU19501.1 | 0 | 16 | 120 | 142 | 248 | unknown [Glycine max] |
| RefSeq | XP_002329161.1 | 0 | 12 | 120 | 368 | 478 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002337954.1 | 0 | 17 | 120 | 1 | 106 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ia7_A | 2e-16 | 16 | 120 | 336 | 432 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
| PDB | 1ia6_A | 2e-16 | 16 | 120 | 336 | 432 | A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum |
| PDB | 1ksd_A | 0.00000000000002 | 16 | 116 | 334 | 426 | A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum |
| PDB | 1ksc_A | 0.00000000000002 | 16 | 116 | 334 | 426 | A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum |
| PDB | 1ks8_A | 0.00000000000002 | 16 | 116 | 334 | 426 | A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5. |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EY685562 | 112 | 16 | 125 | 0 |
| CX663294 | 112 | 16 | 125 | 0 |
| EG026641 | 112 | 16 | 125 | 0 |
| CX670701 | 112 | 16 | 125 | 0 |
| CX665814 | 112 | 16 | 125 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |