Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g044305m |
Family | GH31 |
Protein Properties | Length: 195 Molecular Weight: 22089.8 Isoelectric Point: 5.861 |
Chromosome | Chromosome/Scaffold: 03311 Start: 4428 End: 8345 |
Description | heteroglycan glucosidase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH31 | 25 | 195 | 0 |
VLKDFIYNGVDGIWNDMNEPAVFQSVTKTMPESNIHRGDDEIGGCQNHSYYHNVYGMLMARSTYEGMKLADKDKRPFVLTRAGFIGSQRYAATWTGDNVS NWEHLHMSISMVLQLGLSGQPLSGPDIGGFDGNATPRLFGRWMGIGAMFPFCRGHTESDSIDHEPWSFGEE |
Full Sequence |
---|
Protein Sequence Length: 195 Download |
TVFMPPKWSL GYNQCRWSYD SEKRVLKDFI YNGVDGIWND MNEPAVFQSV TKTMPESNIH 60 RGDDEIGGCQ NHSYYHNVYG MLMARSTYEG MKLADKDKRP FVLTRAGFIG SQRYAATWTG 120 DNVSNWEHLH MSISMVLQLG LSGQPLSGPD IGGFDGNATP RLFGRWMGIG AMFPFCRGHT 180 ESDSIDHEPW SFGEE |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd06604 | GH31_glucosidase_II_MalA | 4.0e-9 | 1 | 40 | 45 | + Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. | ||
PLN02763 | PLN02763 | 1.0e-11 | 1 | 42 | 47 | + hydrolase, hydrolyzing O-glycosyl compounds | ||
cd06603 | GH31_GANC_GANAB_alpha | 1.0e-57 | 36 | 195 | 161 | + This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae. | ||
cd06604 | GH31_glucosidase_II_MalA | 3.0e-85 | 27 | 195 | 170 | + Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This family also includes the MalA alpha-glucosidase from Sulfolobus sulfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source. | ||
PLN02763 | PLN02763 | 4.0e-103 | 25 | 195 | 171 | + hydrolase, hydrolyzing O-glycosyl compounds |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI29244.1 | 0 | 25 | 195 | 120 | 290 | unnamed protein product [Vitis vinifera] |
EMBL | CBI37476.1 | 0.0000001 | 1 | 51 | 257 | 312 | unnamed protein product [Vitis vinifera] |
EMBL | CBI37476.1 | 0 | 25 | 195 | 396 | 566 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002263148.1 | 0.0000001 | 1 | 51 | 174 | 229 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002263148.1 | 0 | 25 | 195 | 312 | 482 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2g3n_F | 4e-28 | 25 | 189 | 305 | 490 | A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine |
PDB | 2g3n_E | 4e-28 | 25 | 189 | 305 | 490 | A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine |
PDB | 2g3n_D | 4e-28 | 25 | 189 | 305 | 490 | A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine |
PDB | 2g3n_C | 4e-28 | 25 | 189 | 305 | 490 | A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine |
PDB | 2g3n_B | 4e-28 | 25 | 189 | 305 | 490 | A Chain A, Glu381ser Mutant Of Maize Cytokinin OxidaseDEHYDROGENASE COMPLEXED With N6-Isopentenyladenosine |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CN187286 | 171 | 25 | 195 | 0 |
EY689465 | 171 | 25 | 195 | 0 |
FR624153 | 167 | 29 | 195 | 0 |
FG496894 | 171 | 25 | 195 | 0 |
FG501570 | 171 | 25 | 195 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|