Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g046094m |
Family | GH18 |
Protein Properties | Length: 246 Molecular Weight: 27639.5 Isoelectric Point: 7.6834 |
Chromosome | Chromosome/Scaffold: 00078 Start: 109869 End: 110966 |
Description | |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH18 | 28 | 184 | 1.6e-21 |
ILSFAIDVDPSGNYQNGKFSPYWAETLTPDSVAAVKARHPNVKALASLSGWSLGSKVLHWYNPRNPQIWISNAFSSLKSIIQEYHLDGIDIDYEKFPMRN ASTPSFAYCIGELITQLKNQSVISVATIAPFYSTALPYIKLYKDYGHVVDYVNYQFY |
Full Sequence |
---|
Protein Sequence Length: 246 Download |
MMEYIGATGI PVKFDSMPIK DGIDFHFILS FAIDVDPSGN YQNGKFSPYW AETLTPDSVA 60 AVKARHPNVK ALASLSGWSL GSKVLHWYNP RNPQIWISNA FSSLKSIIQE YHLDGIDIDY 120 EKFPMRNAST PSFAYCIGEL ITQLKNQSVI SVATIAPFYS TALPYIKLYK DYGHVVDYVN 180 YQFYTDKVRS PRGYLEAFKL RVEQFGREKM VPSYEVNGRG IQGQAFFDAL RLLQANGFEV 240 NGGVL* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd02871 | GH18_chitinase_D-like | 1.0e-5 | 96 | 184 | 104 | + GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus. |
smart00636 | Glyco_18 | 1.0e-7 | 26 | 185 | 176 | + Glyco_18 domain. |
pfam00704 | Glyco_hydro_18 | 1.0e-9 | 26 | 184 | 165 | + Glycosyl hydrolases family 18. |
cd00598 | GH18_chitinase-like | 4.0e-11 | 26 | 184 | 161 | + The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model. |
cd06544 | GH18_narbonin | 3.0e-86 | 1 | 237 | 243 | + Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAI22848.1 | 0 | 3 | 220 | 97 | 312 | chitinase A [Equisetum arvense] |
EMBL | CAN65355.1 | 0 | 1 | 242 | 143 | 381 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002274616.1 | 0 | 1 | 242 | 67 | 305 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002328469.1 | 0 | 2 | 242 | 1 | 238 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002517257.1 | 0 | 1 | 242 | 1 | 239 | Chitinase 1 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3sim_B | 9.99967e-42 | 1 | 237 | 3 | 245 | A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus |
PDB | 3sim_A | 9.99967e-42 | 1 | 237 | 3 | 245 | A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus |
PDB | 1nar_A | 5e-25 | 3 | 217 | 7 | 228 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 2ybu_F | 0.001 | 26 | 178 | 36 | 195 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
PDB | 2ybu_E | 0.001 | 26 | 178 | 36 | 195 | A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DY831286 | 241 | 2 | 242 | 0 |
JG186119 | 190 | 1 | 189 | 0 |
CX712482 | 245 | 3 | 237 | 0 |
GD053871 | 220 | 3 | 217 | 0 |
CO165323 | 246 | 3 | 237 | 1.4013e-45 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |