Basic Information | |
---|---|
Species | Citrus sinensis |
Cazyme ID | orange1.1g047041m |
Family | CBM43 |
Protein Properties | Length: 92 Molecular Weight: 10448.7 Isoelectric Point: 6.0633 |
Chromosome | Chromosome/Scaffold: 00007 Start: 2413910 End: 2414369 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 86 | 4e-33 |
WCIADGQTPDDELQMALDWACGKGGADCNKLQAKQPCYFPNTLRDHASYAFNDYYQKFKHQGATCYFHAAAMITDLDPSHRSCK |
Full Sequence |
---|
Protein Sequence Length: 92 Download |
MEWCIADGQT PDDELQMALD WACGKGGADC NKLQAKQPCY FPNTLRDHAS YAFNDYYQKF 60 KHQGATCYFH AAAMITDLDP SHRSCKFEYR P* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-16 | 3 | 74 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-34 | 3 | 87 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 0 | 2 | 91 | 30 | 119 | unknown [Populus trichocarpa] |
RefSeq | XP_002272811.1 | 0 | 2 | 91 | 29 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 0 | 2 | 91 | 29 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307902.1 | 0 | 2 | 91 | 29 | 118 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 0 | 2 | 91 | 28 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.00000000000002 | 2 | 87 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT500003 | 91 | 2 | 92 | 0 |
CV272267 | 91 | 2 | 92 | 0 |
CV246773 | 91 | 2 | 92 | 0 |
EC945425 | 90 | 2 | 91 | 0 |
CV271912 | 91 | 2 | 92 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|