| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g047283m |
| Family | GH17 |
| Protein Properties | Length: 102 Molecular Weight: 11128.3 Isoelectric Point: 5.0893 |
| Chromosome | Chromosome/Scaffold: 05288 Start: 366 End: 671 |
| Description | beta-1,3-glucanase 2 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 100 | 3.7e-40 |
| LDATYAALEKAGGGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKQGSPKKPDRPIETYIFAMFDEKDKQGAEIERHWGLFAPDKQSKYQVNF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 102 Download |
| LDATYAALEK AGGGSLDIVI SESGWPTAGG DGALTNVDNA RTYNNNLIQH VKQGSPKKPD 60 RPIETYIFAM FDEKDKQGAE IERHWGLFAP DKQSKYQVNF N* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG5309 | COG5309 | 3.0e-5 | 8 | 92 | 89 | + Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | ||
| pfam00332 | Glyco_hydro_17 | 6.0e-51 | 1 | 100 | 100 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAY40462.1 | 0 | 1 | 101 | 238 | 336 | beta-1,3-glucanase class III [Citrus clementina x Citrus reticulata] |
| GenBank | ABK58141.1 | 0 | 1 | 101 | 211 | 309 | beta-1,3-glucanase [Manihot esculenta] |
| GenBank | ABQ45848.1 | 0 | 1 | 101 | 238 | 337 | beta-1,3-glucanase [Citrus unshiu] |
| EMBL | CAA03908.1 | 0 | 1 | 101 | 236 | 336 | beta-1,3-glucanase [Citrus sinensis] |
| RefSeq | XP_002323325.1 | 2.8026e-45 | 1 | 100 | 107 | 203 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 5e-38 | 1 | 101 | 219 | 316 | A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (phaglb-l, O74088_pyrho) From Pyrococcus Horikoshii |
| PDB | 3f55_C | 5e-38 | 1 | 101 | 219 | 316 | A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (phaglb-l, O74088_pyrho) From Pyrococcus Horikoshii |
| PDB | 3f55_B | 5e-38 | 1 | 101 | 219 | 316 | A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (phaglb-l, O74088_pyrho) From Pyrococcus Horikoshii |
| PDB | 3f55_A | 5e-38 | 1 | 101 | 219 | 316 | A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (phaglb-l, O74088_pyrho) From Pyrococcus Horikoshii |
| PDB | 3em5_D | 5e-38 | 1 | 101 | 219 | 316 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CN192291 | 102 | 1 | 102 | 0 |
| CN192309 | 102 | 1 | 102 | 0 |
| CN192421 | 102 | 1 | 102 | 0 |
| CB291815 | 102 | 1 | 102 | 0 |
| CF837987 | 102 | 1 | 102 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |