y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g047411m
FamilyGH28
Protein PropertiesLength: 227 Molecular Weight: 24515.9 Isoelectric Point: 5.99
ChromosomeChromosome/Scaffold: 00396 Start: 30764 End: 33064
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28532251.12104e-44
  TCSATAKSPTMVIPKGKTFLVHPITFTGPCKSSDITIMLSGSIIAPNGPNEWKEDDKSKWFDIQSVDSLQIDGSGTIDGRGKAWWDISCKINKKEGCVKL
  APTVLKFDRCNNLRMNNMNFINSPQTHVTVMGCIGVEFGFLSIQAPGTSPNTDGIHIQASSNVYIHNAHISNG
Full Sequence
Protein Sequence     Length: 227     Download
MDADLCAILY FLYLISTASI RINADEFNVL DFGAAGDGNA DDSMAFIKAW NNTCSATAKS    60
PTMVIPKGKT FLVHPITFTG PCKSSDITIM LSGSIIAPNG PNEWKEDDKS KWFDIQSVDS    120
LQIDGSGTID GRGKAWWDIS CKINKKEGCV KLAPTVLKFD RCNNLRMNNM NFINSPQTHV    180
TVMGCIGVEF GFLSIQAPGT SPNTDGIHIQ ASSNVYIHNA HISNGT*                  240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00295Glyco_hydro_282.0e-3254225172+
PLN03003PLN030031.0e-329225217+
PLN02218PLN022181.0e-3528225200+
PLN03010PLN030103.0e-4022225204+
PLN02793PLN027931.0e-4827225199+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABM67700.102922557250polygalacturonase [Citrus sinensis]
RefSeqXP_002466242.102722575270hypothetical protein SORBIDRAFT_01g004220 [Sorghum bicolor]
RefSeqXP_002515526.1012251216Polygalacturonase-2 precursor, putative [Ricinus communis]
RefSeqXP_002517618.102622510202polygalacturonase, putative [Ricinus communis]
RefSeqXP_002517618.10.000000000003154225470541polygalacturonase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bhe_A0.00000002123225113222A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB3jur_D0.000000082622527259A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C0.000000082622527259A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B0.000000082622527259A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A0.000000082622527259A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT76823322252250
DT76924722252250
DT74019322252250
DT74612522252250
EH721029199272255.99756e-43
Orthologous Group
SpeciesID
Brassica rapaBra040077
Fragaria vescamrna30795.1-v1.0-hybrid
Glycine maxGlyma08g25901.1Glyma17g31721.1
Gossypium raimondiiGorai.011G082300.1
Malus domesticaMDP0000600336MDP0000146841
Prunus persicappa021254m.37.202ppa021254m.37.202
Vitis viniferaGSVIVT01017354001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny