| Basic Information | |
|---|---|
| Species | Citrus sinensis |
| Cazyme ID | orange1.1g047499m |
| Family | GT51 |
| Protein Properties | Length: 152 Molecular Weight: 17364.5 Isoelectric Point: 10.0816 |
| Chromosome | Chromosome/Scaffold: 06349 Start: 1821 End: 2885 |
| Description | |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT51 | 5 | 113 | 3.5e-39 |
| TWQLVKNTFLKNERTISRKIVEMVLALALERAISKWEILSSYVSKIYWGHGIYGIESASIFYFGKHPSLLSMAEAAMLAGMIPAPDLRSPLKDCSRGKTF QARVLKRMV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 152 Download |
| MFQATWQLVK NTFLKNERTI SRKIVEMVLA LALERAISKW EILSSYVSKI YWGHGIYGIE 60 SASIFYFGKH PSLLSMAEAA MLAGMIPAPD LRSPLKDCSR GKTFQARVLK RMVEAGFIDI 120 ETALWVLKQP LDLRDDGKKY ADRLLYLLSF SK |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR02071 | PBP_1b | 1.0e-18 | 5 | 137 | 137 | + penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]. | ||
| COG5009 | MrcA | 9.0e-31 | 5 | 147 | 143 | + Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane] | ||
| COG0744 | MrcB | 2.0e-35 | 5 | 134 | 130 | + Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane] | ||
| TIGR02074 | PBP_1a_fam | 1.0e-37 | 5 | 139 | 135 | + penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]. | ||
| pfam00912 | Transgly | 6.0e-38 | 5 | 113 | 109 | + Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerisation of murein glycan chains. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003824 | catalytic activity |
| GO:0009252 | peptidoglycan biosynthetic process |
| GO:0009274 | peptidoglycan-based cell wall |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAE45868.1 | 0 | 5 | 149 | 251 | 398 | penicillin-binding protein [Physcomitrella patens] |
| EMBL | CAN72729.1 | 3.99931e-42 | 48 | 150 | 951 | 1053 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI19051.1 | 0 | 5 | 150 | 170 | 315 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_001771453.1 | 0 | 5 | 149 | 251 | 398 | penicillin-binding protein [Physcomitrella patens subsp. patens] |
| RefSeq | ZP_01620199.1 | 1e-32 | 5 | 131 | 111 | 237 | Penicillin-binding protein 1A [Lyngbya sp. PCC 8106] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ue1_B | 1e-20 | 5 | 134 | 95 | 224 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3ue1_A | 1e-20 | 5 | 134 | 95 | 224 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3ue0_B | 1e-20 | 5 | 134 | 95 | 224 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3ue0_A | 1e-20 | 5 | 134 | 95 | 224 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 3udx_B | 1e-20 | 5 | 134 | 95 | 224 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EC926211 | 146 | 5 | 150 | 0 |
| DT557994 | 138 | 5 | 142 | 0 |
| EX301431 | 121 | 5 | 125 | 2e-37 |
| DT742315 | 115 | 5 | 108 | 3e-33 |
| DR917962 | 110 | 5 | 114 | 7e-33 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |