y PlantCAZyme

CAZyme Information

Basic Information
SpeciesCitrus sinensis
Cazyme IDorange1.1g047946m
FamilyGH28
Protein PropertiesLength: 322 Molecular Weight: 35053 Isoelectric Point: 6.3446
ChromosomeChromosome/Scaffold: 00079 Start: 515405 End: 516959
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281783072.2e-30
  SSKDILVSEVFCGPGQGISVGSLGKGIKDEEVVGLTVRNCTFTCTSNGVRVKTWPDSHIGIASNFTFEDIVMNNVENPIVIDQLYCPYNKCNIKPKDSMP
  NIEIGNRNLVYNGVNVKVEGPETTSLCSNV
Full Sequence
Protein Sequence     Length: 322     Download
LLLAARFSLL VSFITSVRGI DATNRVLNVK DFGAVADGIT DDSKAFDTSW REAWNWDGIK    60
GTVLVPPGKY LVSFAEFEGP CKASISFQLQ GLLDLFSIDT SLSLAKGTFH GQGETAWPLN    120
QCHKNSDCQL PTPIRFNFLN DSTITGIKSV DSRYFHINIL GCYNLKLNDL KITAHADSSK    180
DILVSEVFCG PGQGISVGSL GKGIKDEEVV GLTVRNCTFT CTSNGVRVKT WPDSHIGIAS    240
NFTFEDIVMN NVENPIVIDQ LYCPYNKCNI KPKDSMPNIE IGNRNLVYNG VNVKVEGPET    300
TSLCSNVKPT LFGKQIPATC V*                                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02793PLN027931.0e-381263332+
PLN02218PLN022183.0e-3910268314+
PLN02155PLN021556.0e-484267312+
pfam00295Glyco_hydro_282.0e-4957308321+
PLN02188PLN021883.0e-7328320367+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABY21306.10173181374pollen allergen Pla o 2 [Platanus orientalis]
Swiss-ProtQ6H9K00183181373PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor
RefSeqXP_002274125.102632127395PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282573.102632027394PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282594.102632027394PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ib4_B0.000016130746333A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1ib4_A0.000016130746333A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1ia5_A0.000016130746333A Chain A, Polygalacturonase From Aspergillus Aculeatus
PDB1bhe_A0.00002190270248322A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB2iq7_G0.000036126242266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO101156283322640
CO101142283322640
CU61706730192600
CO114621285292630
EG525413299182650
Orthologous Group
SpeciesID
Glycine maxGlyma14g23621.1
Malus domesticaMDP0000284808
Populus trichocarpaPotri.012G013600.1
Prunus persicappa012438mppa026186m
Vitis viniferaGSVIVT01020328001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny