CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa001199m
FamilyGH13
Protein PropertiesLength: 884 Molecular Weight: 99370.4 Isoelectric Point: 5.6339
ChromosomeChromosome/Scaffold: 8 Start: 20558073 End: 20560724
Descriptiondebranching enzyme 1
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133917208.4e-29
  TNIGGSFSGLTEKLEHFKDLGVNAVLLEPIFPFDEQKGPYFPHHFFSPMDCFGPSRGPVSAVNSMKEMVRKFHANGIEVLLEVVFTHTAEGEALQGIDIS
  SYYHVNEVEDLEARNALNCNYPIVQQLVLDSLRYWVTEFHVDGFFFINASSLLRGFNGEYLSRPPLVEAIAFDPLLSKTKIIADCWDPHGMAPKETHFPH
  WRRWAEVNTKFCNDVRNFLRGEGLLSDLATRLCGNGDIFSDGRGPAFAFNFISRNSGLPLVDLVSFSGVELASELSWNCGEEGPTNKTAVLERRLKQIRN
  FLFILFVSLGVPVLNMGDECGQSTGGSPAY
Full Sequence
Protein Sequence     Length: 884     Download
MATLPLSIAI QACCFNCGIT ESSKLTATNG FRHRDKAMHG FVKLDAERKL VFREVVQNIN    60
ENLPRDHNLK VYAKSQVSVE PMEQRFSTGT ETEEIDKVST YLFRTEIGDV VNVFVRKRNA    120
KYTVNIEVPS SHLSSNDRRL VLRWGMYRAD SSCFVPLDFK SSTPNDTTTT LETPLIQTSS    180
GRFTLELEFE AKQIPFYFSF ILTSPADANV SDMEIRSHRK TNFCVPVGFG RGYPGPLGLT    240
FSNDGSMNFA IFSRNAESVA LCLYDNTTAE KPALELDLDP YVNRSGDIWH VSFGSAWSFV    300
SYGYKFKGNL LLTNKNNFDE GHVLLDPYAK VIAKSIPNNH GTGLKYLGRL CEEPAFDWAG    360
DVRPDLSMEK LVVYRLNVTR FTEHKSSQLP TNIGGSFSGL TEKLEHFKDL GVNAVLLEPI    420
FPFDEQKGPY FPHHFFSPMD CFGPSRGPVS AVNSMKEMVR KFHANGIEVL LEVVFTHTAE    480
GEALQGIDIS SYYHVNEVED LEARNALNCN YPIVQQLVLD SLRYWVTEFH VDGFFFINAS    540
SLLRGFNGEY LSRPPLVEAI AFDPLLSKTK IIADCWDPHG MAPKETHFPH WRRWAEVNTK    600
FCNDVRNFLR GEGLLSDLAT RLCGNGDIFS DGRGPAFAFN FISRNSGLPL VDLVSFSGVE    660
LASELSWNCG EEGPTNKTAV LERRLKQIRN FLFILFVSLG VPVLNMGDEC GQSTGGSPAY    720
SDRKAFDWNA LETGFATQTT QFIAFLSSFR KRRSDLLQKR NFLKEENIGW YESDQTPPRW    780
EDPSRKFLAM RLKADEDEVN QPGDESSHSW GDLFVAFSAA DHSETVVLPP PLEGMGWRRL    840
VDTALPFPGF FSTDGEPVVE QIVGLFAYEM KSHSCALFEA RSL* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK03705PRK037051.0e-72232830654+
COG1523PulA4.0e-113232846686+
TIGR02100glgX_debranch1.0e-115232848690+
cd11326AmyAc_Glg_debranch2.0e-117356752438+
cd11346AmyAc_plant_IsoA2.0e-138367758405+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAN15318.1018831859isoamylase isoform 2 [Solanum tuberosum]
DDBJBAF52942.106588050860isoamylase-type starch-debranching enzyme 2 [Phaseolus vulgaris]
RefSeqNP_171830.1018801877isoamylase, putative / starch debranching enzyme, putative [Arabidopsis thaliana]
RefSeqXP_002271798.1018831880PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002533079.1018801867isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B023280415652A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme
PDB2vuy_A023280415652A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme
PDB2vr5_B023280415652A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme
PDB2vr5_A023280415652A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme
PDB2vnc_B023280415652A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8176183333697010
GE6350582734617330
DR9266472973786700
FY7829902755838570
ES8176181056787790.028
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)