CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa001312m
FamilyGH13
Protein PropertiesLength: 857 Molecular Weight: 97148.8 Isoelectric Point: 5.2425
ChromosomeChromosome/Scaffold: 7 Start: 14466485 End: 14477964
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133666864.4e-30
  LPRIKRLGYNAVQLMAIQEHSYYASFGYHVTNFFAPSSRCGTPDDLKSLIDRAHELGILVLMDIVHSHASNNVLDGLNMFDGTDSHYFHSGSRGYHWMWD
  SRLFNYGSWEVLRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLEVAFTGNYNEYFGLATDVDAVTYLMLVNDLIHGLYPEAVTIGEDVSGMPTFCVS
  VQDGGVGFDYRLHMAIADKWIELLQKIDEEWQMGDIVHTLTNRRWREKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPATPLVDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 857     Download
MVSTLSGIRF PLLPSAYNNN NDSASLHSSF NGYRRTSSLS LFLTNSSFSR KIFAGKSSYD    60
SDSSLTVAAS KKVLVPDSQS DGSSSVTEQL EAPGTVSEDP QVLEDVDNVA MEDDKKVEDE    120
VKKSDVPSLD AGNVDGTEAK GEETPHPLDG TVSTAKKNAT QKSIPPPGNG KKIYEIDPLL    180
VGFRDHLDYR YGQYKRLREE IDKYEGGLEV FSRGYEKFGF TRSAEGITYR EWAPGAKSAS    240
LIGDFNNWNT NADVMTRNEF GVWEIFLPNN ADGSPPIPHG SRVKIRMDTP SGIKDSIPAW    300
IKFSVQAPGE IPYNGIYYDP PEEENYVFQH SQPKRPKSLR IYEAHVGMSS TEPKINTYAE    360
FRDDVLPRIK RLGYNAVQLM AIQEHSYYAS FGYHVTNFFA PSSRCGTPDD LKSLIDRAHE    420
LGILVLMDIV HSHASNNVLD GLNMFDGTDS HYFHSGSRGY HWMWDSRLFN YGSWEVLRYL    480
LSNARWWLEE YKFDGFRFDG VTSMMYTHHG LEVAFTGNYN EYFGLATDVD AVTYLMLVND    540
LIHGLYPEAV TIGEDVSGMP TFCVSVQDGG VGFDYRLHMA IADKWIELLQ KIDEEWQMGD    600
IVHTLTNRRW REKCVAYAES HDQALVGDKT IAFWLMDKDM YDFMALDRPA TPLVDRGIAL    660
HKMIRLITMG LGGEGYLNFM GNEFGHPEWI DFPRGTQQLP NGKIVPGNNN SFDKCRRRFD    720
LGDANYLRYH GLQEFDQAMQ HLEETYCFMT SEHQYISRKD EGDRVIVFER GNLVFVFNFH    780
WSKSYTDYRV GCLKPGKYKI VLDSDEKLFG GFNRIDHSAE YFTTDGWFDD RPHSFLLYAP    840
CRTAVVYALI AGPAKD* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029609.0e-1018326791+
PLN03244PLN032443.0e-138275849583+
PLN02447PLN024470134850721+
cd11321AmyAc_bac_euk_BE0322737417+
PLN02960PLN029600275849580+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABO31358.1018551844starch branching enzyme II-1 [Malus x domestica]
GenBankABO31359.1018551844starch branching enzyme II-2 [Malus x domestica]
EMBLCAA56319.1018521847starch branching enzyme I [Pisum sativum]
EMBLCBI30261.1018481849unnamed protein product [Vitis vinifera]
RefSeqXP_002277213.10418482441058PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A017384713690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B017384713690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A017384713690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A017384713690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3k1d_A0226845137717A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366831678490
HO7776386272238490
HO4581233954568500
HO4581232961674550
HO777638471762220.0000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)