CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa001639m
FamilyGH13
Protein PropertiesLength: 789 Molecular Weight: 89396.1 Isoelectric Point: 6.5104
ChromosomeChromosome/Scaffold: 1 Start: 41906067 End: 41917841
Descriptionisoamylase 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132816450
  IRGSYLGVIEKIPHLQELGINAVELLPVFEFDEFEFQRRPNPRDHMINTWGYSTINFFAPMSRYASDGGGPLKASQEFKQMVKALHGAGIEVILDVVYNH
  TNEADDANPYTTSFRGIDNKVYYMLDLNNNGQLLNFSGCGNTLNCNHPVVMELIIDSLRHWVTEYHVDGFRFDLASALCRGSDGSPLSAPPVIRAIAKDS
  ILSRCKIISEPWDCGGLYLVGRFPNWDRWAEWNGKYRDDLRRFIKGDSGMKGSFATRVSGSADLYKVNKRKPYHSVNFVIAHDGFTLYDLVSYNFKHNDA
  NGEGGNDGSNDNLSWNCGYEGETDDSTVKAIRSRQMKNFHLALMISQGTPMMLMGDEYGHSRNGN
Full Sequence
Protein Sequence     Length: 789     Download
MLRTPHWYDS HVAKFHLFAS PFSSHNGSSC TVASPVLDMG LKLIKQDEAP QMSETSPSWK    60
TFPGQAFPLG VSEVDSGTNF AIFSQHATAV TLCLSLPERN YSDGDSEKIS DDFSQHDKVS    120
LNLSQSDTRY SSVHASGTFS VNPFFLERLG RVDGGMMEFS LDRNVNKTGD IWHICIKDLP    180
RSNVLYGYRM DGPRGWHEGH RFDSRVVLID PYAKLVDGRR FFGDSSKKFS KFLGTYDFDS    240
LPFAWGDNYK LPNIPEKDLV IYEMNVRAFT ASESSGLDPD IRGSYLGVIE KIPHLQELGI    300
NAVELLPVFE FDEFEFQRRP NPRDHMINTW GYSTINFFAP MSRYASDGGG PLKASQEFKQ    360
MVKALHGAGI EVILDVVYNH TNEADDANPY TTSFRGIDNK VYYMLDLNNN GQLLNFSGCG    420
NTLNCNHPVV MELIIDSLRH WVTEYHVDGF RFDLASALCR GSDGSPLSAP PVIRAIAKDS    480
ILSRCKIISE PWDCGGLYLV GRFPNWDRWA EWNGKYRDDL RRFIKGDSGM KGSFATRVSG    540
SADLYKVNKR KPYHSVNFVI AHDGFTLYDL VSYNFKHNDA NGEGGNDGSN DNLSWNCGYE    600
GETDDSTVKA IRSRQMKNFH LALMISQGTP MMLMGDEYGH SRNGNNNSYG HDTAINHFQW    660
GLLEARNSNH FRFFKEVIKF RRTHRVFGRD TFLEKNDVTW HEDNWHNYES KFLAFTFHDN    720
NGGDVYMAFN AHDYFIKVPI PAAPVKRRWF RVVDTNLESP NDFVLDGVPG IKSTYNMAPY    780
SSILLEAK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02100glgX_debranch2.0e-5639432+
PRK03705PRK037056.0e-141167700550+
cd11326AmyAc_Glg_debranch0243684445+
COG1523PulA063773745+
TIGR02100glgX_debranch0165767646+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ81837.104478840735isoamylase isoform 3 [Pisum sativum]
EMBLCBI19205.101378811774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.101378823786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002301076.104378883818predicted protein [Populus trichocarpa]
RefSeqXP_002513977.1017881781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B016669464601A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a
PDB2vuy_A016669464601A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a
PDB2vr5_B016669464601A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7987254552046580
HO7796252435467880
HO7796251833625440
HO4657002502995480
HO798725356737070.002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)