y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa004581m
FamilyGT10
Protein PropertiesLength: 503 Molecular Weight: 56225.9 Isoelectric Point: 6.9748
ChromosomeChromosome/Scaffold: 8 Start: 14323366 End: 14328574
Descriptionfucosyltransferase 12
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT101473790
  HQTGTASVLRSMESAQYYAENNLAYARRRGYNIIMTTSLSSDVPVGYFSWAEYNIMAPVQPKTETALAAAFISNCGARNFRLQALEALESAKIKIDSYGG
  CHRNRDGKVDKVETLKRYKFSLAFENSNEEDYVTEKYFQSLVAGSIPVVVGAPNIEDFAPAPGAVLHIKEINDVEPVAKRMKYLADNPEAYNQSLRWKYE
  GPSDSFKALVDMAAVHSSCRLCIHLATMIREKE
Full Sequence
Protein Sequence     Length: 503     Download
MGVFSTQRGS RTATTQEGLP VSGGISTAPK RKWSNLMPFF VALVVIAEIA FLGKLDIAKN    60
TALVDSWADL FSPAPLIHEL AVESDDLGLL SCEEWLERED AAEYSRDFEK EPILVSGDEK    120
EWKSCSVGCQ FGFNPSQKPD AAFGLAHQTG TASVLRSMES AQYYAENNLA YARRRGYNII    180
MTTSLSSDVP VGYFSWAEYN IMAPVQPKTE TALAAAFISN CGARNFRLQA LEALESAKIK    240
IDSYGGCHRN RDGKVDKVET LKRYKFSLAF ENSNEEDYVT EKYFQSLVAG SIPVVVGAPN    300
IEDFAPAPGA VLHIKEINDV EPVAKRMKYL ADNPEAYNQS LRWKYEGPSD SFKALVDMAA    360
VHSSCRLCIH LATMIREKEE MSQGSKSRPC KCTRGSAVVY HLYVRERGRF EMESIFLRSG    420
NLTLGAFESL VLTKFKSQKH VPIWKQERPE SIRGGDDFKI YRIYPVGMTQ RQALYTFRFN    480
GDADFRRHVE SNPCAKFEVI LV*                                            540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00852Glyco_transf_104.0e-35178377207+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008417fucosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL99371.10125028505alpha 1,3 fucosyltransferase [Medicago sativa]
EMBLCAB52254.1015022510Fuct c3 protein [Vigna radiata var. radiata]
EMBLCAI70373.1015021522alpha 1,3 fucosyltransferase [Populus alba x Populus tremula]
RefSeqXP_002285245.1015021504PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313854.1015021523predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nzy_C0.0000001215351183315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2nzy_B0.0000001215351183315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2nzy_A0.0000001215351183315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2nzx_C0.0000001215351183315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2nzx_B0.0000001215351183315A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7327912821954760
CO0767162631454070
DW4934302632415030
JG8664882821254060
CK1204862611373970
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00060.3Aquca_015_00060.1Aquca_015_00060.2
Arabidopsis lyrata891881891885479443
Arabidopsis thalianaAT3G19280.1AT1G49710.1
Brachypodium distachyonBradi3g38160.2Bradi3g38160.1
Brassica rapaBra014210Bra018801Bra022408
Carica papayaevm.model.supercontig_62.7
Capsella rubellaCarubv10015682mCarubv10008875m
Chlamydomonas reinhardtiig18110.t1
Citrus clementinaCiclev10028212m
Citrus sinensisorange1.1g038682m
Cucumis sativusCucsa.219830.2Cucsa.219830.1Cucsa.219830.4Cucsa.244420.1Cucsa.219830.5
Cucsa.219830.3
Eucalyptus grandisEucgr.I01147.2Eucgr.I01147.1Eucgr.I01147.3
Fragaria vescamrna28254.1-v1.0-hybrid
Glycine maxGlyma07g33580.1Glyma02g14890.1Glyma07g33580.2
Gossypium raimondiiGorai.013G044300.2Gorai.002G008200.2Gorai.008G024900.1Gorai.013G044300.1Gorai.002G008200.1
Linum usitatissimumLus10027899Lus10014060Lus10002401Lus10019855
Malus domesticaMDP0000275804MDP0000322244
Manihot esculentacassava4.1_005385mcassava4.1_009428m
Medicago truncatulaMedtr4g086010.1
Mimulus guttatusmgv1a005269m
Oryza sativaLOC_Os08g36840.1
Panicum virgatumPavirv00032486m
Physcomitrella patensPp1s31_233V6.3Pp1s31_233V6.1
Phaseolus vulgarisPhvul.003G292000.1
Picea abiesMA_100562g0010
Populus trichocarpaPotri.009G101500.3Potri.009G101500.4Potri.009G101500.1Potri.009G101500.2
Ricinus communis29801.m003181
Setaria italicaSi013627m
Selaginella moellendorffii164166
Sorghum bicolorSb07g022980.1
Thellungiella halophilaThhalv10011402m
Vitis viniferaGSVIVT01031736001
Volvox carteriVocar20004454m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny