Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa010673m |
Family | AA2 |
Protein Properties | Length: 241 Molecular Weight: 26312.1 Isoelectric Point: 8.0961 |
Chromosome | Chromosome/Scaffold: 6 Start: 6274406 End: 6277207 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 26 | 225 | 0 |
FIAEKACAPLMLRIAWHSAGTYDSRTKTGGPFGTMKHAAEQSHGANAGLDIAVRLLEPIKQQFPILSYADFYQLAGVVAVEITGGPDVPFHPGREDKPEP PPEGRLPDATKGNDHLRDVFGKTMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTPNPLIFDNSYFTVLLSEKYDGLLMLPTDTALLSDPVFRPLVEKYA |
Full Sequence |
---|
Protein Sequence Length: 241 Download |
MGKSYPTVSE EYKKAIDKAK RKLRGFIAEK ACAPLMLRIA WHSAGTYDSR TKTGGPFGTM 60 KHAAEQSHGA NAGLDIAVRL LEPIKQQFPI LSYADFYQLA GVVAVEITGG PDVPFHPGRE 120 DKPEPPPEGR LPDATKGNDH LRDVFGKTMG LSDQDIVALS GGHTLGRCHK ERSGFEGPWT 180 PNPLIFDNSY FTVLLSEKYD GLLMLPTDTA LLSDPVFRPL VEKYAAVRVF LSSKSLHLCT 240 * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 3.0e-56 | 17 | 227 | 239 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 1.0e-122 | 6 | 225 | 220 | + L-ascorbate peroxidase | ||
PLN02879 | PLN02879 | 8.0e-127 | 1 | 226 | 226 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 2.0e-131 | 1 | 226 | 226 | + L-ascorbate peroxidase 1 | ||
cd00691 | ascorbate_peroxidase | 9.0e-136 | 5 | 226 | 230 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAO14118.1 | 0 | 1 | 226 | 1 | 226 | AF457210_1 ascorbate peroxidase [Hevea brasiliensis] |
GenBank | AAX84679.1 | 0 | 1 | 226 | 1 | 226 | ascorbate peroxidase APX2 [Manihot esculenta] |
GenBank | ABP87792.1 | 0 | 1 | 226 | 1 | 226 | ascorbate peroxidase [Malus x domestica] |
GenBank | ACJ84589.1 | 0 | 1 | 226 | 1 | 226 | unknown [Medicago truncatula] |
Swiss-Prot | P48534 | 0 | 1 | 226 | 1 | 226 | APX1_PEA RecName: Full=L-ascorbate peroxidase, cytosolic; Short=AP; AltName: Full=PsAPx01 |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 2 | 226 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 2 | 226 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 2 | 226 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 2 | 226 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 0 | 2 | 226 | 1 | 225 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FC862066 | 216 | 1 | 216 | 0 |
FC860777 | 206 | 1 | 206 | 0 |
DW354936 | 206 | 18 | 223 | 0 |
DW353677 | 204 | 1 | 204 | 0 |
EX680681 | 226 | 1 | 226 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|