| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa015278m |
| Family | CBM43 |
| Protein Properties | Length: 107 Molecular Weight: 11578.2 Isoelectric Point: 8.742 |
| Chromosome | Chromosome/Scaffold: 4 Start: 3748687 End: 3749280 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 25 | 102 | 3.2e-29 |
| WCVAKPAAPQHALQSALDYACNYADCSPTKKGGSCYDPDRPVHHVSFAMNAYYQKMGRNQWNCHLNNTSLISLADPSR | |||
| Full Sequence |
|---|
| Protein Sequence Length: 107 Download |
| MAKLALPGPV SSLLLLFFFS GTKSWCVAKP AAPQHALQSA LDYACNYADC SPTKKGGSCY 60 DPDRPVHHVS FAMNAYYQKM GRNQWNCHLN NTSLISLADP SRPSIS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-15 | 24 | 92 | 79 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 3.0e-28 | 24 | 101 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI30841.1 | 6e-23 | 16 | 101 | 86 | 171 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_001772420.1 | 1e-22 | 23 | 101 | 429 | 509 | predicted protein [Physcomitrella patens subsp. patens] |
| RefSeq | XP_002275460.1 | 3e-23 | 16 | 101 | 26 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002285661.1 | 5e-23 | 16 | 106 | 22 | 112 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002528491.1 | 7e-25 | 1 | 101 | 1 | 110 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 1e-17 | 24 | 101 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
