Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa015282m |
Family | CBM43 |
Protein Properties | Length: 85 Molecular Weight: 9319.42 Isoelectric Point: 8.7442 |
Chromosome | Chromosome/Scaffold: 4 Start: 4140134 End: 4140388 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 80 | 5e-30 |
WCVAKPAAPQHALQSARDYACNYADCSPTKKGGSCYDPDRPVHHASFAMNAYYQKMGRNQWNCHFNNTSLISLADPSR |
Full Sequence |
---|
Protein Sequence Length: 85 Download |
KAWCVAKPAA PQHALQSARD YACNYADCSP TKKGGSCYDP DRPVHHASFA MNAYYQKMGR 60 NQWNCHFNNT SLISLADPSR PSIS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-15 | 3 | 70 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 8.0e-28 | 3 | 79 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_177973.4 | 2e-22 | 1 | 79 | 30 | 108 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_001772420.1 | 5e-23 | 1 | 79 | 429 | 509 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_002285661.1 | 1e-22 | 1 | 82 | 29 | 110 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300444.1 | 2e-22 | 1 | 79 | 30 | 108 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 4e-23 | 1 | 79 | 32 | 110 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-18 | 2 | 79 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EL383526 | 79 | 1 | 79 | 4e-25 |
EL403617 | 79 | 1 | 79 | 6e-25 |
EH704398 | 79 | 1 | 79 | 6e-25 |
DK950175 | 81 | 1 | 79 | 3e-24 |
EY049375 | 79 | 1 | 79 | 4e-24 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|