| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa016442m |
| Family | GH1 |
| Protein Properties | Length: 137 Molecular Weight: 15803.7 Isoelectric Point: 8.7064 |
| Chromosome | Chromosome/Scaffold: 6 Start: 13725541 End: 13726778 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 2 | 117 | 1.19951e-42 |
| PIAPWGLQRLLEYMKQNYGNPPIYIHENGQQTARNSSLEDRSRVKYLRGHIQSLLAAVRNGSNARGYFIWSFMDSLELLNGYESSFGLYYIDLDDPDLKR QPKLSAHWYSHFLKSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 137 Download |
| YPIAPWGLQR LLEYMKQNYG NPPIYIHENG QQTARNSSLE DRSRVKYLRG HIQSLLAAVR 60 NGSNARGYFI WSFMDSLELL NGYESSFGLY YIDLDDPDLK RQPKLSAHWY SHFLKSKNLT 120 SLDGFLESLS HGYHSQ* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 2.0e-31 | 1 | 110 | 113 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 7.0e-34 | 1 | 117 | 120 | + Glycosyl hydrolase family 1. | ||
| PLN02814 | PLN02814 | 5.0e-42 | 5 | 115 | 111 | + beta-glucosidase | ||
| PLN02998 | PLN02998 | 3.0e-44 | 1 | 115 | 115 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 1.0e-46 | 1 | 118 | 120 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI36851.1 | 0 | 1 | 127 | 415 | 540 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36854.1 | 0 | 1 | 121 | 539 | 659 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36854.1 | 0 | 1 | 122 | 26 | 147 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002267595.1 | 0 | 1 | 121 | 367 | 487 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002268189.1 | 0 | 1 | 121 | 284 | 404 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 1e-27 | 3 | 114 | 387 | 503 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3ptq_A | 1e-27 | 3 | 114 | 387 | 503 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3ptm_B | 1e-27 | 3 | 114 | 387 | 503 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3ptm_A | 1e-27 | 3 | 114 | 387 | 503 | A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi |
| PDB | 3ptk_B | 1e-27 | 3 | 114 | 387 | 503 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DY647390 | 118 | 1 | 118 | 0 |
| GO513780 | 137 | 1 | 137 | 0 |
| CN444713 | 137 | 1 | 137 | 0 |
| DR995933 | 137 | 1 | 137 | 0 |
| CO414758 | 135 | 3 | 137 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |