Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa017122m |
Family | CBM43 |
Protein Properties | Length: 79 Molecular Weight: 8575.73 Isoelectric Point: 4.4238 |
Chromosome | Chromosome/Scaffold: 4 Start: 3740593 End: 3740829 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 78 | 3.5e-21 |
WCVPKPGTPDSALQNIINFTCGILKECSEIQEHGSCYFPNTLINHAPFAMNLSYKTDGCYNCDFNCVGLIVVTNPS |
Full Sequence |
---|
Protein Sequence Length: 79 Download |
DTWCVPKPGT PDSALQNIIN FTCGILKECS EIQEHGSCYF PNTLINHAPF AMNLSYKTDG 60 CYNCDFNCVG LIVVTNPS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-9 | 2 | 67 | 73 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-21 | 2 | 78 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU14756.1 | 1e-16 | 1 | 78 | 36 | 115 | unknown [Glycine max] |
EMBL | CAN83700.1 | 2e-16 | 3 | 78 | 240 | 317 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002283660.1 | 4e-16 | 3 | 78 | 321 | 398 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002519722.1 | 2e-17 | 1 | 78 | 132 | 210 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 0.00000000005 | 2 | 78 | 31 | 108 | hypothetical protein RCOM_0633850 [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-16 | 2 | 78 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BI432827 | 79 | 2 | 78 | 5e-19 |
AI485092 | 79 | 2 | 78 | 8e-19 |
AI485513 | 79 | 2 | 78 | 1e-18 |
BQ515336 | 79 | 2 | 78 | 1e-18 |
CK267612 | 79 | 2 | 78 | 2e-18 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|