| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa017122m |
| Family | CBM43 |
| Protein Properties | Length: 79 Molecular Weight: 8575.73 Isoelectric Point: 4.4238 |
| Chromosome | Chromosome/Scaffold: 4 Start: 3740593 End: 3740829 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 3 | 78 | 3.5e-21 |
| WCVPKPGTPDSALQNIINFTCGILKECSEIQEHGSCYFPNTLINHAPFAMNLSYKTDGCYNCDFNCVGLIVVTNPS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 79 Download |
| DTWCVPKPGT PDSALQNIIN FTCGILKECS EIQEHGSCYF PNTLINHAPF AMNLSYKTDG 60 CYNCDFNCVG LIVVTNPS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 4.0e-9 | 2 | 67 | 73 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 4.0e-21 | 2 | 78 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU14756.1 | 1e-16 | 1 | 78 | 36 | 115 | unknown [Glycine max] |
| EMBL | CAN83700.1 | 2e-16 | 3 | 78 | 240 | 317 | hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002283660.1 | 4e-16 | 3 | 78 | 321 | 398 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| RefSeq | XP_002519722.1 | 2e-17 | 1 | 78 | 132 | 210 | hypothetical protein RCOM_0633850 [Ricinus communis] |
| RefSeq | XP_002519722.1 | 0.00000000005 | 2 | 78 | 31 | 108 | hypothetical protein RCOM_0633850 [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-16 | 2 | 78 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BI432827 | 79 | 2 | 78 | 5e-19 |
| AI485092 | 79 | 2 | 78 | 8e-19 |
| AI485513 | 79 | 2 | 78 | 1e-18 |
| BQ515336 | 79 | 2 | 78 | 1e-18 |
| CK267612 | 79 | 2 | 78 | 2e-18 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |