Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa017726m |
Family | CBM43 |
Protein Properties | Length: 99 Molecular Weight: 11060.3 Isoelectric Point: 4.3588 |
Chromosome | Chromosome/Scaffold: 4 Start: 365583 End: 365967 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 10 | 93 | 2.1e-32 |
WCIADEQTPDEELQMALNWACQVGGADCSKIQENQACYLPNTLQHHASYAFNNYYQKLKQQGGTCYFNAAAFVTALDPSHNSCK |
Full Sequence |
---|
Protein Sequence Length: 99 Download |
MKGGQLEEEW CIADEQTPDE ELQMALNWAC QVGGADCSKI QENQACYLPN TLQHHASYAF 60 NNYYQKLKQQ GGTCYFNAAA FVTALDPSHN SCKFEYLP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-15 | 10 | 80 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-32 | 10 | 94 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 0 | 8 | 98 | 29 | 119 | unknown [Populus trichocarpa] |
RefSeq | XP_002272811.1 | 0 | 4 | 98 | 24 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002272918.1 | 0 | 4 | 98 | 24 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002307902.1 | 0 | 8 | 98 | 28 | 118 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 0 | 8 | 98 | 27 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000000000005 | 9 | 95 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT500003 | 92 | 8 | 99 | 1.4013e-45 |
EC945425 | 95 | 4 | 98 | 1.4013e-45 |
CV272267 | 92 | 8 | 99 | 1.4013e-45 |
CO981054 | 92 | 8 | 99 | 1.4013e-45 |
BU081023 | 92 | 8 | 99 | 1.4013e-45 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|