CAZyme Information

Basic Information
SpeciesPrunus persica
Cazyme IDppa018196m
FamilyGH100
Protein PropertiesLength: 122 Molecular Weight: 13943.1 Isoelectric Point: 9.6439
ChromosomeChromosome/Scaffold: 4 Start: 12871571 End: 12873201
Descriptioncytosolic invertase 2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH100121084.2039e-43
  EVSWSYHNGGCWPTLLWLLTAACIETGRPQTAKTAIEQVEQRLSKDGWPEYYDGKAGRYIRKQARKYQTWSISGYLVAKLMIENPTNLSLIFLEEDK
Full Sequence
Protein Sequence     Length: 122     Download
MPTKFMTPPL EEVSWSYHNG GCWPTLLWLL TAACIETGRP QTAKTAIEQV EQRLSKDGWP    60
EYYDGKAGRY IRKQARKYQT WSISGYLVAK LMIENPTNLS LIFLEEDKKI AKPRLTRSAS    120
F* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02703PLN027035.0e-411117139+
PLN02973PLN029734.0e-481121134+
PLN03005PLN030051.0e-491121134+
pfam12899Glyco_hydro_1004.0e-50196109+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ80874.10112141173neutral invertase [Nicotiana langsdorffii x Nicotiana sanderae]
RefSeqXP_001758344.101120332464predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001782510.1015120429534predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002301418.101120334466predicted protein [Populus trichocarpa]
RefSeqXP_002525039.101121563696beta-fructofuranosidase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE25944213511220
AJ79149313411210
EX92319913411210
GR14811813411210
CK44415713411210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00008.3Aquca_073_00008.2Aquca_073_00008.1Aquca_086_00036.1Aquca_004_00040.2
Aquca_004_00040.1Aquca_003_00442.1Aquca_073_00027.1
Arabidopsis lyrata489803491170472504891210316170
489110474815896781896678920675
332600
Arabidopsis thalianaAT4G34860.2AT4G34860.1AT4G09510.1AT1G22650.1AT1G72000.1
AT1G35580.2AT1G35580.1AT4G09510.2AT1G35580.3AT5G22510.1
AT1G56560.1AT3G06500.1AT3G05820.1
Brachypodium distachyonBradi3g45530.1Bradi5g10357.1Bradi4g24470.1Bradi3g02560.1Bradi4g24470.2
Bradi2g12427.1Bradi5g09200.1Bradi3g44770.1Bradi1g64150.1
Brassica rapaBra011567Bra034661Bra034659Bra024527Bra000681
Bra016091Bra034413Bra036761Bra002417Bra038926
Bra029583Bra040252
Carica papayaevm.model.supercontig_37.198evm.model.supercontig_66.27evm.model.supercontig_48.185evm.model.supercontig_19.1
Capsella rubellaCarubv10004468mCarubv10000493mCarubv10021707mCarubv10012014mCarubv10009286m
Carubv10000472mCarubv10020003mCarubv10013138mCarubv10015452mCarubv10000738m
Citrus clementinaCiclev10030393mCiclev10023282mCiclev10028002mCiclev10030926mCiclev10030925m
Ciclev10004474mCiclev10000500mCiclev10003220m
Citrus sinensisorange1.1g035779morange1.1g048475morange1.1g006338morange1.1g006332morange1.1g006329m
orange1.1g006328morange1.1g006324morange1.1g006488morange1.1g005783morange1.1g006131m
orange1.1g015270morange1.1g045990morange1.1g008699morange1.1g013067morange1.1g007986m
orange1.1g008801morange1.1g010424morange1.1g016169morange1.1g035960m
Cucumis sativusCucsa.381840.1Cucsa.079400.1Cucsa.309020.1Cucsa.252410.1Cucsa.090510.1
Cucsa.252410.2
Eucalyptus grandisEucgr.G01751.1Eucgr.F02588.1Eucgr.F01661.1Eucgr.D02386.1Eucgr.G02704.2
Eucgr.G02704.1Eucgr.J00457.3Eucgr.J00457.2Eucgr.J00457.1Eucgr.B03984.1
Eucgr.H03308.1Eucgr.H03308.2Eucgr.G02704.3
Fragaria vescamrna07792.1-v1.0-hybridmrna08524.1-v1.0-hybridmrna07379.1-v1.0-hybridmrna18695.1-v1.0-hybridmrna05019.1-v1.0-hybrid
mrna00239.1-v1.0-hybridmrna22002.1-v1.0-hybrid.383.643mrna22002.1-v1.0-hybrid.383.643mrna22002.1-v1.0-hybrid.156.364mrna22002.1-v1.0-hybrid.156.364
mrna26695.1-v1.0-hybrid
Glycine maxGlyma10g35890.4Glyma10g35890.3Glyma20g31730.2Glyma20g31730.1Glyma12g02690.2
Glyma04g00750.5Glyma04g00750.4Glyma04g00750.3Glyma04g00750.2Glyma06g00770.3
Glyma06g00770.2Glyma05g31920.2Glyma05g31920.1Glyma08g15220.1Glyma20g22780.1
Glyma10g28640.1Glyma17g04160.1Glyma07g36440.1Glyma03g38970.2Glyma19g41500.2
Glyma17g04160.2Glyma11g10400.2.237.371Glyma11g10400.2.237.371
Gossypium raimondiiGorai.005G252100.2Gorai.005G252100.1Gorai.013G139600.2Gorai.013G139600.1Gorai.006G130500.3
Gorai.006G130500.2Gorai.006G130500.1Gorai.009G289200.1Gorai.002G123500.1Gorai.004G151200.1
Gorai.007G110200.1Gorai.006G130500.4Gorai.009G289200.2Gorai.006G110700.1Gorai.011G203600.1
Gorai.002G145500.6Gorai.002G145500.5Gorai.002G145500.4Gorai.002G145500.3Gorai.002G145500.2
Gorai.002G145500.1Gorai.013G208200.2Gorai.013G208200.1Gorai.012G023500.1Gorai.004G235500.1
Gorai.007G308100.1Gorai.013G130600.1Gorai.006G110700.2Gorai.011G203600.2Gorai.006G110700.3
Gorai.002G145500.7Gorai.004G235500.2Gorai.004G235500.4Gorai.004G235500.3
Linum usitatissimumLus10042390Lus10033144Lus10026284Lus10034525Lus10014824
Lus10016938Lus10006078Lus10019532Lus10043375Lus10037817
Lus10017095Lus10010900Lus10031431Lus10009441.256.528Lus10009441.256.528
Lus10009441.88.195Lus10009441.88.195
Malus domesticaMDP0000163452MDP0000319075MDP0000186866MDP0000849174MDP0000531557
MDP0000146680MDP0000297851MDP0000652278MDP0000133399MDP0000095481
MDP0000315220MDP0000275203MDP0000261740MDP0000798088MDP0000133829
MDP0000291284
Manihot esculentacassava4.1_005201mcassava4.1_004783mcassava4.1_004474mcassava4.1_004633mcassava4.1_022884m
cassava4.1_003659mcassava4.1_003155mcassava4.1_002913mcassava4.1_021277mcassava4.1_002971m
cassava4.1_025660m
Medicago truncatulaMedtr1g096140.1Medtr1g095970.1Medtr3g117710.1Medtr8g092170.1Medtr1g084610.1
Medtr3g015100.1
Mimulus guttatusmgv1a005865mmgv1a003765mmgv1a023298mmgv1a002815mmgv1a005735m
mgv1a002478mmgv1a002839mmgv1a002360mmgv1a006717m
Oryza sativaLOC_Os02g34560.1LOC_Os04g35280.1LOC_Os11g07440.3LOC_Os11g07440.1LOC_Os02g03320.1
LOC_Os02g34560.2LOC_Os11g07440.4LOC_Os11g07440.2LOC_Os02g32730.1LOC_Os01g22900.1
LOC_Os03g20020.1LOC_Os04g33490.1LOC_Os01g22900.3LOC_Os01g22900.2
Panicum virgatumPavirv00040169mPavirv00015193mPavirv00065954mPavirv00063699mPavirv00064389m
Pavirv00045650mPavirv00000123mPavirv00050023mPavirv00060635mPavirv00019972m
Pavirv00039825mPavirv00059532mPavirv00039824mPavirv00017654mPavirv00063916m
Pavirv00053033m.234.378Pavirv00053033m.234.378
Physcomitrella patensPp1s227_41V6.1Pp1s261_25V6.1Pp1s32_177V6.1Pp1s333_36V6.1Pp1s245_40V6.1
Pp1s15_44V6.1Pp1s279_35V6.1Pp1s313_22V6.1
Phaseolus vulgarisPhvul.007G091300.1Phvul.009G000400.1Phvul.002G266600.1Phvul.007G203100.1Phvul.001G224200.1
Phvul.003G118400.1
Picea abiesMA_7394g0010MA_10436888g0010MA_116385g0010MA_89855g0010MA_10427675g0010
MA_10427685g0010MA_10429278g0010.102.302MA_10429278g0010.102.302MA_458344g0010MA_10425903g0010
MA_3665942g0010MA_6692890g0010MA_10309672g0010MA_182953g0010MA_10429278g0010.338.431
MA_10429278g0010.338.431
Populus trichocarpaPotri.004G167500.1Potri.013G110800.1Potri.019G082000.3Potri.019G082000.2Potri.019G082000.1
Potri.009G129000.1Potri.005G239400.1Potri.002G173600.1Potri.004G186500.1Potri.010G236100.1
Potri.008G024100.2Potri.008G024100.1Potri.008G101500.3Potri.008G101500.2Potri.008G101500.1
Potri.013G006600.1Potri.005G010800.2Potri.005G010800.1Potri.004G186500.2Potri.013G006600.2
Potri.010G236100.2
Prunus persicappa004112mppa003483mppa003670mppa025225mppa002149m
ppa002625mppa002614mppa002847mppa002385mppa019684m
ppa014917mppb023165m
Ricinus communis29728.m00079929836.m00058329791.m00054629766.m00011629889.m003349
30128.m00893529711.m000330.251.52129711.m000330.251.52130170.m014184.294.48030170.m014184.294.480
30170.m014184.135.29330170.m014184.135.29356962.m00005529711.m000330.112.22929711.m000330.112.229
56962.m000054
Setaria italicaSi016798mSi009717mSi026182mSi016786mSi016890m
Si016691mSi000681mSi034714mSi009683m
Selaginella moellendorffii11139389558151264267827443960
Sorghum bicolorSb04g022350.1Sb04g029440.1Sb05g004770.1Sb04g002180.1Sb03g013420.1
Sb04g021550.1Sb01g037120.1Sb02g032885.1
Thellungiella halophilaThhalv10024783mThhalv10028553mThhalv10007305mThhalv10001814mThhalv10019647m
Thhalv10012973mThhalv10020219mThhalv10023341mThhalv10020291mThhalv10017815m
Vitis viniferaGSVIVT01009904001GSVIVT01034488001GSVIVT01027176001GSVIVT01024105001GSVIVT01037430001
GSVIVT01031374001GSVIVT01034944001GSVIVT01031267001GSVIVT01037429001GSVIVT01034754001
GSVIVT01034753001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)