| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa019248m |
| Family | GH1 |
| Protein Properties | Length: 140 Molecular Weight: 16392.8 Isoelectric Point: 8.3931 |
| Chromosome | Chromosome/Scaffold: 6 Start: 3772565 End: 3773453 |
| Description | beta glucosidase 32 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 11 | 137 | 1.6e-30 |
| DYYQDKLLSYLLCKLCGSQQASYLIDARVNQSCWYLYVYPKGIHDLLLYIKKKYNNPLIYIIENNVDELNDPSLSLAQALNDTNRIDYYHNHIYYVKTAI KKSTKVKGYFTWLLLNNFEWNSGYTVQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 140 Download |
| MLIGSLSHGP DYYQDKLLSY LLCKLCGSQQ ASYLIDARVN QSCWYLYVYP KGIHDLLLYI 60 KKKYNNPLIY IIENNVDELN DPSLSLAQAL NDTNRIDYYH NHIYYVKTAI KKSTKVKGYF 120 TWLLLNNFEW NSGYTVQLST |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02814 | PLN02814 | 2.0e-13 | 33 | 135 | 103 | + beta-glucosidase | ||
| COG2723 | BglB | 1.0e-14 | 48 | 135 | 91 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PRK13511 | PRK13511 | 9.0e-16 | 44 | 134 | 95 | + 6-phospho-beta-galactosidase; Provisional | ||
| TIGR03356 | BGL | 8.0e-22 | 48 | 135 | 91 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-24 | 36 | 136 | 104 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAA93234.2 | 4.00001e-40 | 28 | 139 | 365 | 489 | amygdalin hydrolase isoform AH I precursor [Prunus serotina] |
| GenBank | AAL07489.1 | 5e-40 | 28 | 139 | 340 | 464 | AF414606_1 amygdalin hydrolase isoform AH I precursor [Prunus serotina] |
| GenBank | ABI34907.3 | 8e-37 | 45 | 139 | 272 | 366 | glycoside hydrolase family 1 protein [Leucaena leucocephala] |
| GenBank | ABY48758.1 | 2e-36 | 45 | 139 | 385 | 479 | glycosylhydrolase 1 [Leucaena leucocephala] |
| GenBank | ACD65511.1 | 3e-36 | 42 | 139 | 392 | 488 | beta-glucosidase D7 [Lotus japonicus] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 1e-32 | 42 | 139 | 367 | 463 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_B | 2e-31 | 32 | 139 | 358 | 478 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_A | 2e-31 | 32 | 139 | 358 | 478 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_B | 2e-31 | 32 | 139 | 358 | 478 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_A | 2e-31 | 32 | 139 | 358 | 478 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FF685187 | 125 | 28 | 139 | 4.00001e-40 |
| AW560545 | 93 | 47 | 139 | 5e-39 |
| CA990354 | 98 | 42 | 139 | 5e-39 |
| DY669396 | 125 | 28 | 139 | 6e-39 |
| GO034111 | 98 | 42 | 139 | 6e-39 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Prunus persica | ppa026712m | ppa026632m | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |