| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa021824m |
| Family | GH1 |
| Protein Properties | Length: 160 Molecular Weight: 18677.8 Isoelectric Point: 5.2554 |
| Chromosome | Chromosome/Scaffold: 6 Start: 13797327 End: 13798352 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 2 | 101 | 9.8e-29 |
| PVTPWGLQQVLEYVKQNYGNPPIYIQENGQRTRRNSSLEDWPREWINVRGYFIWSFLDSLELLDGYESGYGLYYIDLDDPDLRRQPKLSAHWYSQFLKRK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 160 Download |
| FPVTPWGLQQ VLEYVKQNYG NPPIYIQENG QRTRRNSSLE DWPREWINVR GYFIWSFLDS 60 LELLDGYESG YGLYYIDLDD PDLRRQPKLS AHWYSQFLKR KNVISLDGCW TMFWEFSETK 120 AMGSGVKEIK SDEPGFVGHN NVKTYSASHG YADSEWKIS* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 4.0e-18 | 2 | 94 | 112 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 7.0e-23 | 2 | 101 | 119 | + Glycosyl hydrolase family 1. | ||
| PLN02814 | PLN02814 | 9.0e-33 | 1 | 99 | 115 | + beta-glucosidase | ||
| PLN02998 | PLN02998 | 4.0e-33 | 4 | 99 | 112 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 3.0e-34 | 1 | 102 | 120 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI36851.1 | 5.99756e-43 | 1 | 103 | 415 | 533 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36854.1 | 5.00264e-43 | 1 | 106 | 26 | 147 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36854.1 | 9.99995e-41 | 1 | 109 | 539 | 662 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002267643.1 | 4.99983e-42 | 1 | 103 | 532 | 650 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002268189.1 | 9.99967e-42 | 1 | 105 | 284 | 404 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 5e-18 | 3 | 100 | 372 | 490 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 2rgm_B | 2e-17 | 3 | 100 | 366 | 481 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 2rgm_A | 2e-17 | 3 | 100 | 366 | 481 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 2rgl_B | 2e-17 | 3 | 100 | 366 | 481 | A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase |
| PDB | 2rgl_A | 2e-17 | 3 | 100 | 366 | 481 | A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CN444713 | 127 | 1 | 111 | 0 |
| GO513780 | 127 | 1 | 111 | 0 |
| DR995933 | 127 | 1 | 111 | 0 |
| CO414758 | 125 | 3 | 111 | 0 |
| CO866702 | 124 | 4 | 111 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |