Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa022144m |
Family | GT47 |
Protein Properties | Length: 99 Molecular Weight: 11720.7 Isoelectric Point: 9.3437 |
Chromosome | Chromosome/Scaffold: 7 Start: 19022195 End: 19022549 |
Description | Exostosin family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT47 | 2 | 92 | 2e-27 |
ERTLKIYIDKDGNKPIFHQPILKGLYASEGWLLKLMQGYKRFVVKDPRKAHLFYMPFTDAREYSEKIAAKYPYWNRTGGADHFLVACHDWA |
Full Sequence |
---|
Protein Sequence Length: 99 Download |
MERTLKIYID KDGNKPIFHQ PILKGLYASE GWLLKLMQGY KRFVVKDPRK AHLFYMPFTD 60 AREYSEKIAA KYPYWNRTGG ADHFLVACHD WACYPCIFP |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam03016 | Exostosin | 9.0e-19 | 1 | 92 | 112 | + Exostosin family. The EXT family is a family of tumour suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0016020 | membrane |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN76867.1 | 2e-36 | 1 | 91 | 332 | 443 | hypothetical protein [Vitis vinifera] |
EMBL | CAN76867.1 | 9.00054e-42 | 1 | 94 | 1061 | 1175 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28020.1 | 2.99878e-43 | 1 | 94 | 390 | 504 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002283936.1 | 5.99994e-41 | 1 | 94 | 77 | 191 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002514248.1 | 7.00649e-45 | 1 | 94 | 343 | 457 | catalytic, putative [Ricinus communis] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DW344180 | 120 | 1 | 99 | 0 |
CO415110 | 115 | 1 | 94 | 0 |
BQ915067 | 115 | 1 | 94 | 0 |
BQ916995 | 115 | 1 | 94 | 0 |
BQ968701 | 115 | 1 | 94 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |