| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa022480m |
| Family | GH17 |
| Protein Properties | Length: 149 Molecular Weight: 16062.4 Isoelectric Point: 4.9503 |
| Chromosome | Chromosome/Scaffold: 4 Start: 19685451 End: 19685963 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 4 | 91 | 2.7e-26 |
| IGVCYGRVAKNLPPDPEVISLYQANGITRMRIFYPNPPTLQALSNIELIIGVQNLDIHSLGNDVAAATALLENNVLNYFPDVKFRYLA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 149 Download |
| AEPIGVCYGR VAKNLPPDPE VISLYQANGI TRMRIFYPNP PTLQALSNIE LIIGVQNLDI 60 HSLGNDVAAA TALLENNVLN YFPDVKFRYL AQDQIKVSTA IDMSLLGSSY PPSAGSFSKA 120 ASSYINPIIT FLASNGSLLL AYVYPYFS* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-48 | 4 | 148 | 177 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB82772.2 | 8.00141e-43 | 2 | 148 | 27 | 206 | beta-1, 3-glucananse [Musa acuminata AAA Group] |
| GenBank | AAF08679.1 | 7.00649e-43 | 2 | 148 | 9 | 188 | beta-1,3-glucanase [Musa acuminata] |
| GenBank | AAR06588.1 | 1.96182e-44 | 4 | 148 | 30 | 210 | beta-1,3-glucanase [Vitis riparia] |
| RefSeq | XP_002299791.1 | 0 | 1 | 148 | 25 | 204 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002336706.1 | 0 | 1 | 148 | 10 | 189 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 9.80909e-45 | 4 | 148 | 1 | 178 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 1.99993e-41 | 4 | 148 | 2 | 182 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 1.99993e-41 | 4 | 148 | 2 | 182 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 1.99993e-41 | 4 | 148 | 2 | 182 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 1.99993e-41 | 4 | 148 | 2 | 182 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FN755099 | 181 | 1 | 148 | 0 |
| CV130830 | 181 | 1 | 148 | 0 |
| CU547015 | 181 | 1 | 148 | 9.80909e-45 |
| HS059434 | 181 | 1 | 148 | 1.96182e-44 |
| CU544922 | 181 | 1 | 148 | 2.94273e-44 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |