Basic Information | |
---|---|
Species | Prunus persica |
Cazyme ID | ppa024262m |
Family | CBM43 |
Protein Properties | Length: 82 Molecular Weight: 9019.47 Isoelectric Point: 8.631 |
Chromosome | Chromosome/Scaffold: 4 Start: 7182218 End: 7182716 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 25 | 78 | 5e-22 |
WCVTKPAAPQHALQSALDYACNYADCSPTKKGGSCYDPDRPVHHASFAMNAYYP |
Full Sequence |
---|
Protein Sequence Length: 82 Download |
MAKLALPGPV ISLLLLFFFS GKKAWCVTKP AAPQHALQSA LDYACNYADC SPTKKGGSCY 60 DPDRPVHHAS FAMNAYYPWQ IQ |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-10 | 25 | 77 | 63 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-19 | 25 | 77 | 54 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC33206.1 | 0.00000000000007 | 23 | 77 | 135 | 189 | Unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002339854.1 | 0.00000000000003 | 20 | 80 | 166 | 228 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 0.00000000003 | 13 | 77 | 12 | 84 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 0.00000000000002 | 22 | 77 | 131 | 186 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002528491.1 | 0.00000000000005 | 1 | 77 | 1 | 86 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000006 | 24 | 77 | 12 | 66 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
Transmembrane Domains | ||||
---|---|---|---|---|
Start | End | |||
4 | 21 |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
24 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EY745502 | 55 | 24 | 78 | 2e-16 |
EY049375 | 75 | 6 | 80 | 0.000000000000009 |
EL400901 | 57 | 23 | 77 | 0.00000000000002 |
BM093862 | 82 | 3 | 82 | 0.00000000000003 |
EY745502 | 58 | 20 | 77 | 0.0000000000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|