| Basic Information | |
|---|---|
| Species | Prunus persica |
| Cazyme ID | ppa024262m |
| Family | CBM43 |
| Protein Properties | Length: 82 Molecular Weight: 9019.47 Isoelectric Point: 8.631 |
| Chromosome | Chromosome/Scaffold: 4 Start: 7182218 End: 7182716 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 25 | 78 | 5e-22 |
| WCVTKPAAPQHALQSALDYACNYADCSPTKKGGSCYDPDRPVHHASFAMNAYYP | |||
| Full Sequence |
|---|
| Protein Sequence Length: 82 Download |
| MAKLALPGPV ISLLLLFFFS GKKAWCVTKP AAPQHALQSA LDYACNYADC SPTKKGGSCY 60 DPDRPVHHAS FAMNAYYPWQ IQ 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 3.0e-10 | 25 | 77 | 63 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 4.0e-19 | 25 | 77 | 54 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAC33206.1 | 0.00000000000007 | 23 | 77 | 135 | 189 | Unknown protein [Arabidopsis thaliana] |
| RefSeq | XP_002339854.1 | 0.00000000000003 | 20 | 80 | 166 | 228 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002519722.1 | 0.00000000003 | 13 | 77 | 12 | 84 | hypothetical protein RCOM_0633850 [Ricinus communis] |
| RefSeq | XP_002519722.1 | 0.00000000000002 | 22 | 77 | 131 | 186 | hypothetical protein RCOM_0633850 [Ricinus communis] |
| RefSeq | XP_002528491.1 | 0.00000000000005 | 1 | 77 | 1 | 86 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.000000006 | 24 | 77 | 12 | 66 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Transmembrane Domains | ||||
|---|---|---|---|---|
| Start | End | |||
| 4 | 21 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
| Cleavage Site | ||||
| 24 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EY745502 | 55 | 24 | 78 | 2e-16 |
| EY049375 | 75 | 6 | 80 | 0.000000000000009 |
| EL400901 | 57 | 23 | 77 | 0.00000000000002 |
| BM093862 | 82 | 3 | 82 | 0.00000000000003 |
| EY745502 | 58 | 20 | 77 | 0.0000000000002 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |